BP913668
Clone id YMU001_000032_H10
Library
Length 536
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000032_H10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGGCCGAAAAATCTTGGGTTTTGATTGGAAATAGCCCGCTTTCCTTTACAGTGTTTGAT
TCAAAATTTGCAAACCTTACAACCCACTTTGATTCTGTGGGAGTAAAACAATGATCGTAT
TCCTTTCATTCTAACAATTTATGGACTTGCCGCTGATAAATATCCCTCTTCTATGTCTGA
AATGCTAGTAGTCTCCTGCCTGTATGAAAGCCTCTTTTTATGAGTTGCTGTGTCTGTTGC
CTCCTAGAGATAGAGGTCTTCATGCCACACAACTTCTTCCTTACTCCACATTGGCAGCTT
ACTCCCTGAGAATGAGCTTTCAACAAGCCCTGTGATCCCTGTGGTGAGTAAAGATTGTCG
AATCCAGCAAGACGTAGAGAGATGATTGACCCTTGGTCTACTACGTCTTTTTTGTGCCAG
CGTCAACATTCATAGCCCAGTTGAGTATTTCCACATCTTCAGTTTGTCCTTCCCCTGCTG
ATTGAGGTGCACCATGAAGACTTACATCACTGTCTGCTGCATTGGAGATCCCTTCG
■■Homology search results ■■ -
sp_hit_id Q21P93
Definition sp|Q21P93|UREE_SACD2 Urease accessory protein ureE OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Align length 54
Score (bit) 32.7
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913668|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_H10.
(536 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q21P93|UREE_SACD2 Urease accessory protein ureE OS=Saccharoph... 33 1.1
sp|Q6RSS2|L_PIRVV RNA-directed RNA polymerase OS=Pirital virus (... 31 4.3
sp|P34985|OL143_MOUSE Olfactory receptor 143 OS=Mus musculus GN=... 30 5.7

>sp|Q21P93|UREE_SACD2 Urease accessory protein ureE
OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 /
DSM 17024) GN=ureE PE=3 SV=1
Length = 168

Score = 32.7 bits (73), Expect = 1.1
Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
Frame = -1

Query: 332 QGLLKAHSQGVSCQCGVRKKLCGMKTSISR--RQQTQQLIKRGFHTGRRLLAFQ 177
+G + AH +G+ +CG + K S+S + T QL++ +H G R + Q
Sbjct: 50 RGYVLAHGEGLQSKCGEIITVVAAKESVSEVTAENTHQLMRAAYHLGNRHVPLQ 103


>sp|Q6RSS2|L_PIRVV RNA-directed RNA polymerase OS=Pirital virus
(isolate Rat/Venezuela/VAV-488/1995) GN=L PE=3 SV=1
Length = 2210

Score = 30.8 bits (68), Expect = 4.3
Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 4/121 (3%)
Frame = -3

Query: 363 IRQSLLTTGITGLV----ESSFSGSKLPMWSKEEVVWHEDLYL*EATDTATHKKRLSYRQ 196
+++ L + GIT + SS+ +P W E++ WH + + + L Y +
Sbjct: 125 VKKDLQSHGITLVPMIDGRSSYYVEFMPDWVVEKIRWHLIKLMDLLKEDGESVEELEYER 184

Query: 195 ETTSISDIEEGYLSAASP*IVRMKGIRSLFYSHRIKVGCKVCKF*IKHCKGKRAISNQNP 16
+S+S +E L S ++ +GI + +I G + CKG+ QN
Sbjct: 185 LVSSLSALENQSLGLESLLSIKERGIEYIDRLTKIMYGNLNNNMSVDECKGEILRIYQNF 244

Query: 15 R 13
R
Sbjct: 245 R 245


>sp|P34985|OL143_MOUSE Olfactory receptor 143 OS=Mus musculus
GN=Olfr143 PE=2 SV=2
Length = 313

Score = 30.4 bits (67), Expect = 5.7
Identities = 13/27 (48%), Positives = 20/27 (74%)
Frame = +2

Query: 392 LGLLRLFCASVNIHSPVEYFHIFSLSF 472
L L+ L C + N+H+P+ YF +F+LSF
Sbjct: 46 LTLMNLICLNSNLHTPM-YFFLFNLSF 71


tr_hit_id B3QV55
Definition tr|B3QV55|B3QV55_CHLT3 Putative uncharacterized protein OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Align length 53
Score (bit) 33.5
E-value 7.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913668|Adiantum capillus-veneris mRNA, clone:
YMU001_000032_H10.
(536 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3QV55|B3QV55_CHLT3 Putative uncharacterized protein OS=Chlor... 33 7.2
tr|A8TF49|A8TF49_METVO Protein tyrosine phosphatase OS=Methanoco... 33 7.2

>tr|B3QV55|B3QV55_CHLT3 Putative uncharacterized protein
OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
GN=Ctha_0538 PE=4 SV=1
Length = 73

Score = 33.5 bits (75), Expect = 7.2
Identities = 18/53 (33%), Positives = 30/53 (56%)
Frame = -3

Query: 315 SFSGSKLPMWSKEEVVWHEDLYL*EATDTATHKKRLSYRQETTSISDIEEGYL 157
SFSG ++ + K VVWH Y+ E T + + ++ T S+S++E+ YL
Sbjct: 17 SFSGDEVNVLMKNGVVWHG--YVQEVTGSDVKLRDTRFKVHTLSLSEVEKLYL 67


>tr|A8TF49|A8TF49_METVO Protein tyrosine phosphatase
OS=Methanococcus voltae A3 GN=MvolDRAFT_0621 PE=4 SV=1
Length = 169

Score = 33.5 bits (75), Expect = 7.2
Identities = 15/48 (31%), Positives = 30/48 (62%)
Frame = -1

Query: 335 SQGLLKAHSQGVSCQCGVRKKLCGMKTSISRRQQTQQLIKRGFHTGRR 192
+QG+ K++S ++C CG + + C K+ S++QQ ++++ H RR
Sbjct: 5 NQGMQKSNSN-LNCDCGCKNQRCTSKSKNSKKQQKEKILFVCAHNKRR 51