BP913694
Clone id YMU001_000033_C02
Library
Length 554
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000033_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTGTGAGAAAGAGAGAGCACCATACATCAAATACACAGCCATTTCTGAACATACATTGGC
TCTTTTTTACTATAACTGGTCATTCGACCACCAAAATCAGAAAGTGTAAGCCTACGTACT
TTGCCTTGAGAAATAACTGGCTTAAAATTGCAGGGACTAAAGAATTTTCAGAAAATGGAA
GATTCGACAGTAAAAGAGAGTATGGTGGTTGAATCCCAGCTTCATTTTTGGCTTTGTTTC
AATAAACTTCACACGTGATCGGTCTCTGACCTGAAAGAAACTACTTCGAAGGTCCTCTTC
ATCATCCTTCCTTTGCATCCAAACATCCGATGACATAGGGCAATCGATTTCTTGTCGTTT
GCTCACTTCGTTCTGAAGAAACCTAATGGTAGCTTGATCATCGGCCACCCTTGCCTCATC
CAGAGGTGTAAAACCATGCCTGTCCTTAGCCAAAACATCAGCACCCTCCCTAACTAGAAC
TGCTGCTGCCTCAGTGTTCCCTTCTGCAGCAGCGACGTGTAAAGGCGTCCGATCTCCATA
GTCGGATGCATTAG
■■Homology search results ■■ -
sp_hit_id Q94A76
Definition sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana
Align length 69
Score (bit) 53.9
E-value 5.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913694|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_C02.
(554 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thali... 54 5e-07
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thali... 50 1e-05
sp|Q8N9V6|ANR53_HUMAN Ankyrin repeat domain-containing protein 5... 44 5e-04
sp|Q4R739|ANR53_MACFA Ankyrin repeat domain-containing protein 5... 43 0.001
sp|Q3V0J4|ANR53_MOUSE Ankyrin repeat domain-containing protein 5... 42 0.003
sp|Q19013|GLS1_CAEEL Putative glutaminase DH11.1 OS=Caenorhabdit... 41 0.003
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 reg... 39 0.013
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 reg... 37 0.084
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 1... 36 0.11
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus G... 36 0.11
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=1 36 0.14
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A... 36 0.14
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 1... 36 0.14
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 1... 36 0.14
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 reg... 35 0.19
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 reg... 35 0.19
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 reg... 35 0.19
sp|Q7T2B9|MTPN_DANRE Myotrophin OS=Danio rerio GN=mtpn PE=2 SV=1 35 0.25
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicu... 35 0.25
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat doma... 35 0.25
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS... 35 0.32
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 1... 35 0.32
sp|Q4UJC0|Y2042_RICFE Putative ankyrin repeat protein RF_p42/RF_... 34 0.42
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium di... 34 0.42
sp|Q8BXK8|AGAP1_MOUSE Arf-GAP, GTPase, ANK repeat and PH domain-... 34 0.42
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 ... 34 0.55
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus m... 34 0.55
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo ... 34 0.55
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos t... 34 0.55
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thali... 34 0.55

>sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana
GN=GORK PE=1 SV=2
Length = 820

Score = 53.9 bits (128), Expect = 5e-07
Identities = 27/69 (39%), Positives = 40/69 (57%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N+ DY RTPLHV +LV GA V++KDR G +PLDEAR+ ++ I+ L+
Sbjct: 655 NSEDYDHRTPLHVAASEGLFLMAKMLVEAGASVISKDRWGNSPLDEARLCGNKKLIKLLE 714

Query: 372 NEVSKRQEI 346
+ + + I
Sbjct: 715 DVKNAQSSI 723



Score = 44.7 bits (104), Expect = 3e-04
Identities = 24/62 (38%), Positives = 31/62 (50%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N +DY R+PLH+ L++EG DV KD+ G TPL EA A + I L
Sbjct: 558 NKTDYDGRSPLHLAACRGYEDITLFLIQEGVDVNLKDKFGHTPLFEAVKAGQEGVIGLLV 617

Query: 372 NE 367
E
Sbjct: 618 KE 619


>sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana
GN=SKOR PE=1 SV=1
Length = 828

Score = 49.7 bits (117), Expect = 1e-05
Identities = 27/61 (44%), Positives = 34/61 (55%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N+ DY RTPLHV LV A+VLAKDR G TPLDEA ++ I+ L+
Sbjct: 672 NSKDYDHRTPLHVAASEGFYVLAIQLVEASANVLAKDRWGNTPLDEALGCGNKMLIKLLE 731

Query: 372 N 370
+
Sbjct: 732 D 732



Score = 37.4 bits (85), Expect = 0.049
Identities = 19/47 (40%), Positives = 25/47 (53%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEA 412
N +DY R+PLH+ L++E DV KD+ G TPL EA
Sbjct: 575 NKTDYDGRSPLHLAASRGYEDITLYLIQESVDVNIKDKLGSTPLLEA 621


>sp|Q8N9V6|ANR53_HUMAN Ankyrin repeat domain-containing protein 53
OS=Homo sapiens GN=ANKRD53 PE=2 SV=1
Length = 530

Score = 43.9 bits (102), Expect = 5e-04
Identities = 23/70 (32%), Positives = 38/70 (54%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
NA TPLH+ VLV+ GA+V A+D G+ P+D ++ + +A RFL+
Sbjct: 205 NAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQDAMGYKPIDFCKIWNHRACARFLK 264

Query: 372 NEVSKRQEID 343
+ + K+ + D
Sbjct: 265 DAMWKKDKKD 274


>sp|Q4R739|ANR53_MACFA Ankyrin repeat domain-containing protein 53
OS=Macaca fascicularis GN=ANKRD53 PE=2 SV=1
Length = 496

Score = 43.1 bits (100), Expect = 0.001
Identities = 23/70 (32%), Positives = 38/70 (54%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
NA TPLH+ VLV+ GA+V A+D G+ P+D ++ + +A RFL+
Sbjct: 171 NAQTCNGCTPLHLAVREGLLDCVKVLVQSGANVHAQDAMGYKPIDFCKIWNHRACARFLK 230

Query: 372 NEVSKRQEID 343
+ + K+ + D
Sbjct: 231 DAMWKKDKKD 240


>sp|Q3V0J4|ANR53_MOUSE Ankyrin repeat domain-containing protein 53
OS=Mus musculus GN=Ankrd53 PE=2 SV=1
Length = 497

Score = 41.6 bits (96), Expect = 0.003
Identities = 21/68 (30%), Positives = 36/68 (52%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N+ Y TPLH+ +LV+ GA+V A+D GF P++ R+ + + RFL+
Sbjct: 176 NSQTYNGSTPLHLASCNGLLGCIKLLVQSGANVHARDATGFKPINYCRLWNHRTCARFLK 235

Query: 372 NEVSKRQE 349
+ + K +
Sbjct: 236 DVMWKHDK 243


>sp|Q19013|GLS1_CAEEL Putative glutaminase DH11.1 OS=Caenorhabditis
elegans GN=DH11.1 PE=2 SV=2
Length = 605

Score = 41.2 bits (95), Expect = 0.003
Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREG-ADVLAKDRHGFTPLDEARVADDQATIRFL 376
N SD+ DRT LH+ LV DV KDR G TPLDEA+ RFL
Sbjct: 508 NTSDHDDRTVLHIAATEGYETMIKFLVNVAKVDVDKKDRWGRTPLDEAKFFKHDHVSRFL 567

Query: 375 QNEVSKRQE 349
+ + + ++
Sbjct: 568 EKAMKRPEQ 576


>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6
regulatory ankyrin repeat subunit C OS=Danio rerio
GN=ankrd52 PE=2 SV=1
Length = 1071

Score = 39.3 bits (90), Expect = 0.013
Identities = 23/72 (31%), Positives = 35/72 (48%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
+ASD DR P+H +LV +G+D KD+ G+TPL A + +++L
Sbjct: 167 SASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYL- 225

Query: 372 NEVSKRQEIDCP 337
+ EID P
Sbjct: 226 --LRNGAEIDEP 235



Score = 35.0 bits (79), Expect = 0.25
Identities = 20/59 (33%), Positives = 27/59 (45%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFL 376
NA D RTPLH +L+ GA+V AKD TPL A + ++ + L
Sbjct: 35 NALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLL 93



Score = 34.3 bits (77), Expect = 0.42
Identities = 18/44 (40%), Positives = 25/44 (56%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPL 421
NA D+ TPLH +L+R+GADV A+D++ TPL
Sbjct: 68 NAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPL 111



Score = 33.5 bits (75), Expect = 0.71
Identities = 19/44 (43%), Positives = 21/44 (47%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPL 421
N D RTPLH VLV GA+V +DR G TPL
Sbjct: 450 NKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPL 493


>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6
regulatory ankyrin repeat subunit B OS=Mus musculus
GN=Ankrd44 PE=2 SV=1
Length = 993

Score = 36.6 bits (83), Expect = 0.084
Identities = 21/61 (34%), Positives = 29/61 (47%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
NA D DR LH A+L+ GA+V KD+ G+TPL A + ++ L
Sbjct: 167 NAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLL 226

Query: 372 N 370
N
Sbjct: 227 N 227



Score = 35.4 bits (80), Expect = 0.19
Identities = 21/59 (35%), Positives = 27/59 (45%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFL 376
NA D RTPLHV +L+ GA V AKD TPL A + + ++ L
Sbjct: 35 NALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVL 93



Score = 30.8 bits (68), Expect = 4.6
Identities = 24/77 (31%), Positives = 32/77 (41%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
NA D TPLH VL++ ADV A+D++ TPL A
Sbjct: 68 NAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAA----------- 116

Query: 372 NEVSKRQEIDCPMSSDV 322
N+ K E+ P+ S V
Sbjct: 117 NKAVKCAEVIIPLLSSV 133


>sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A
OS=Gallus gallus GN=PPP1R12A PE=1 SV=1
Length = 1004

Score = 36.2 bits (82), Expect = 0.11
Identities = 26/85 (30%), Positives = 39/85 (45%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N D PLH L+ +GA V A + G TPLD +A+++A LQ
Sbjct: 100 NQPDNEGWIPLHAAASCGYLDIAEYLISQGAHVGAVNSEGDTPLD---IAEEEAMEELLQ 156

Query: 372 NEVSKRQEIDCPMSSDVWMQRKDDE 298
NEV+++ D+ RK++E
Sbjct: 157 NEVNRQ-------GVDIEAARKEEE 174


>sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus
GN=Aspg PE=1 SV=1
Length = 564

Score = 36.2 bits (82), Expect = 0.11
Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N DY +TPLHV +L++ GADV A++ G +PL A Q+ I L+
Sbjct: 425 NLKDYSGQTPLHVAARRGHAAVVTMLLQRGADVDARNEDGQSPLLLAVRGRHQSVIGLLR 484

Query: 372 NEVSK--RQEIDCPMSSDVWMQRKDDEEDLRS 283
++ QE++ + + + D E LR+
Sbjct: 485 AAGARLSPQELEDVGTELCRLASRGDSEGLRA 516


tr_hit_id A9SFL8
Definition tr|A9SFL8|A9SFL8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 118
Score (bit) 61.6
E-value 3.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913694|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_C02.
(554 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SFL8|A9SFL8_PHYPA Predicted protein OS=Physcomitrella paten... 62 3e-08
tr|A7PHB7|A7PHB7_VITVI Chromosome chr17 scaffold_16, whole genom... 56 1e-06
tr|A7PF93|A7PF93_VITVI Chromosome chr11 scaffold_13, whole genom... 56 1e-06
tr|A5AP20|A5AP20_VITVI Putative uncharacterized protein OS=Vitis... 56 1e-06
tr|B8A2M2|B8A2M2_MAIZE Putative uncharacterized protein OS=Zea m... 53 1e-05
tr|B8A288|B8A288_MAIZE Putative uncharacterized protein OS=Zea m... 53 1e-05
tr|B7ZX13|B7ZX13_MAIZE Putative uncharacterized protein OS=Zea m... 53 1e-05
tr|Q7XUW4|Q7XUW4_ORYSJ OSJNBa0027P08.8 protein OS=Oryza sativa s... 51 5e-05
tr|Q0JCX5|Q0JCX5_ORYSJ Os04g0445000 protein (Fragment) OS=Oryza ... 51 5e-05
tr|Q01J41|Q01J41_ORYSA OSIGBa0140O07.2 protein OS=Oryza sativa G... 51 5e-05
tr|B7EY26|B7EY26_ORYSJ cDNA clone:001-127-D12, full insert seque... 51 5e-05
tr|B1PC61|B1PC61_POPEU Outward rectifying potassium channel OS=P... 51 5e-05
tr|A3AU76|A3AU76_ORYSJ Putative uncharacterized protein OS=Oryza... 51 5e-05
tr|A2XTX0|A2XTX0_ORYSI Putative uncharacterized protein OS=Oryza... 51 5e-05
tr|Q9FY05|Q9FY05_9ROSI Outward rectifying potassium channel OS=P... 50 6e-05
tr|A8IF21|A8IF21_CHLRE Predicted protein OS=Chlamydomonas reinha... 50 8e-05
tr|Q0WVI7|Q0WVI7_ARATH Stelar K+ outward rectifying channel OS=A... 50 1e-04
tr|Q5NT78|Q5NT78_TOBAC Potassium channel TORK1 OS=Nicotiana taba... 49 2e-04
tr|A7Q7P8|A7Q7P8_VITVI Chromosome chr18 scaffold_61, whole genom... 49 2e-04
tr|Q653P0|Q653P0_ORYSJ Os06g0250600 protein OS=Oryza sativa subs... 47 7e-04
tr|A3BAA7|A3BAA7_ORYSJ Putative uncharacterized protein OS=Oryza... 47 7e-04
tr|A2YBA9|A2YBA9_ORYSI Putative uncharacterized protein OS=Oryza... 47 7e-04
tr|A9SM41|A9SM41_PHYPA Predicted protein OS=Physcomitrella paten... 46 0.001
tr|A5AVS5|A5AVS5_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|Q4E602|Q4E602_TRYCR 6-phosphofructo-2-kinase/fructose-2, 6-bi... 45 0.003
tr|Q7XI53|Q7XI53_ORYSJ Putative ankyrin-kinase OS=Oryza sativa s... 45 0.003
tr|Q0D4E0|Q0D4E0_ORYSJ Os07g0632800 protein OS=Oryza sativa subs... 45 0.003
tr|B8B4X3|B8B4X3_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.003
tr|A3BMI5|A3BMI5_ORYSJ Putative uncharacterized protein OS=Oryza... 45 0.003
tr|Q9STP8|Q9STP8_ARATH Putative acyl-CoA binding protein (AT4g27... 44 0.004

>tr|A9SFL8|A9SFL8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_164636 PE=4 SV=1
Length = 625

Score = 61.6 bits (148), Expect = 3e-08
Identities = 41/118 (34%), Positives = 54/118 (45%), Gaps = 27/118 (22%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDR---------------------- 439
N +DY RTPLH+ LV +GADV AKDR
Sbjct: 491 NETDYSQRTPLHIVAADGTAKDAEFLVHKGADVFAKDRYALNFPYFSTRLNEHSLEIAKI 550

Query: 438 -----HGFTPLDEARVADDQATIRFLQNEVSKRQEIDCPMSSDVWMQRKDDEEDLRSS 280
HG+TPLDEA+ +D++AT+R L+ V+ RQ Q+ DDEED +S
Sbjct: 551 MLSCSHGYTPLDEAQGSDNKATLRVLEAAVALRQ------------QQLDDEEDYSTS 596



Score = 42.7 bits (99), Expect = 0.013
Identities = 24/65 (36%), Positives = 34/65 (52%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
+++DY RTPLH+ A+LV GA++ KD G TPL EA T + L+
Sbjct: 394 SSTDYEGRTPLHLAAGKGHSECVALLVERGAEINIKDNDGVTPLLEALKGGHDWTAKILR 453

Query: 372 NEVSK 358
N +K
Sbjct: 454 NNGAK 458


>tr|A7PHB7|A7PHB7_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017882001
PE=4 SV=1
Length = 729

Score = 55.8 bits (133), Expect = 1e-06
Identities = 28/64 (43%), Positives = 38/64 (59%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
NA +Y RTPLH+ +L+ GA VLAKDR G TPLDEAR+ ++ I+ L+
Sbjct: 571 NAKNYDSRTPLHLAASEGLYSMTNLLLEAGASVLAKDRWGNTPLDEARIGGNKNLIKLLE 630

Query: 372 NEVS 361
+S
Sbjct: 631 EAMS 634


>tr|A7PF93|A7PF93_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016959001
PE=4 SV=1
Length = 748

Score = 55.8 bits (133), Expect = 1e-06
Identities = 28/64 (43%), Positives = 38/64 (59%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
NA +Y RTPLH+ +L+ GA VLAKDR G TPLDEAR+ ++ I+ L+
Sbjct: 590 NAKNYDSRTPLHLAASEGLYSMTNLLLEAGASVLAKDRWGNTPLDEARIGGNKNLIKLLE 649

Query: 372 NEVS 361
+S
Sbjct: 650 EAMS 653


>tr|A5AP20|A5AP20_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_012637 PE=4 SV=1
Length = 834

Score = 55.8 bits (133), Expect = 1e-06
Identities = 28/64 (43%), Positives = 38/64 (59%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
NA +Y RTPLH+ +L+ GA VLAKDR G TPLDEAR+ ++ I+ L+
Sbjct: 676 NAKNYDSRTPLHLAASEGLYSMTNLLLEAGASVLAKDRWGNTPLDEARIGGNKNLIKLLE 735

Query: 372 NEVS 361
+S
Sbjct: 736 EAMS 739


>tr|B8A2M2|B8A2M2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 585

Score = 53.1 bits (126), Expect = 1e-05
Identities = 28/61 (45%), Positives = 35/61 (57%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N +Y RTPLHV ++LV GADVLAKDR G TPLDE R + +R L+
Sbjct: 522 NCRNYDQRTPLHVAAAEGLHLVASMLVGFGADVLAKDRWGNTPLDEGRRCSSRPLVRILE 581

Query: 372 N 370
+
Sbjct: 582 H 582


>tr|B8A288|B8A288_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 592

Score = 53.1 bits (126), Expect = 1e-05
Identities = 28/61 (45%), Positives = 35/61 (57%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N +Y RTPLHV ++LV GADVLAKDR G TPLDE R + +R L+
Sbjct: 529 NCRNYDQRTPLHVAAAEGLHLVASMLVGFGADVLAKDRWGNTPLDEGRRCSSRPLVRILE 588

Query: 372 N 370
+
Sbjct: 589 H 589


>tr|B7ZX13|B7ZX13_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 607

Score = 52.8 bits (125), Expect = 1e-05
Identities = 28/60 (46%), Positives = 34/60 (56%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N +Y RTPLHV ++LV GADVLAKDR G TPLDE R + +R L+
Sbjct: 522 NCRNYDQRTPLHVAAAEGLHLVASMLVGFGADVLAKDRWGNTPLDEGRRCSSRPLVRILE 581


>tr|Q7XUW4|Q7XUW4_ORYSJ OSJNBa0027P08.8 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0027P08.8 PE=4 SV=2
Length = 719

Score = 50.8 bits (120), Expect = 5e-05
Identities = 24/60 (40%), Positives = 32/60 (53%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N +Y RTPLH+ + L+ GAD+ AKDR G TPLDE R + +R L+
Sbjct: 652 NCRNYDQRTPLHIAAAEGLHLVASTLIESGADIQAKDRWGNTPLDEGRRCSSKPLVRILE 711


>tr|Q0JCX5|Q0JCX5_ORYSJ Os04g0445000 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os04g0445000 PE=4 SV=1
Length = 454

Score = 50.8 bits (120), Expect = 5e-05
Identities = 24/60 (40%), Positives = 32/60 (53%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N +Y RTPLH+ + L+ GAD+ AKDR G TPLDE R + +R L+
Sbjct: 387 NCRNYDQRTPLHIAAAEGLHLVASTLIESGADIQAKDRWGNTPLDEGRRCSSKPLVRILE 446


>tr|Q01J41|Q01J41_ORYSA OSIGBa0140O07.2 protein OS=Oryza sativa
GN=OSIGBa0140O07.2 PE=4 SV=1
Length = 719

Score = 50.8 bits (120), Expect = 5e-05
Identities = 24/60 (40%), Positives = 32/60 (53%)
Frame = -3

Query: 552 NASDYGDRTPLHVXXXXXXXXXXAVLVREGADVLAKDRHGFTPLDEARVADDQATIRFLQ 373
N +Y RTPLH+ + L+ GAD+ AKDR G TPLDE R + +R L+
Sbjct: 652 NCRNYDQRTPLHIAAAEGLHLVASTLIESGADIQAKDRWGNTPLDEGRRCSSKPLVRILE 711