BP913700
Clone id YMU001_000033_C09
Library
Length 464
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000033_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGAGCAAACCAGAACGTCGACCCACAAAGCATATGCCCTCTCCTTTGGCTTGGAATATT
ATTTTCAACTCTGCCTTCTCCTACTATGCTTACTACATCTATGCAAATCTTTACACTCTC
AACAAGCTTCGGGAATCAAAAGGAATGTCGATCATAAAATTCCGCCCTCACTCTGGTGAG
GCTGGTGAGCAAGACCATTTGGTGGCAACCTTTATACTTTCTCACAATATAGCCCATGGG
AACAATCTGCGCAAGTCACCTGCCTTGCAGTACTTATACTATTTGGCTCAGATTGGCTTG
TGCATGTCTCCGTTAAGCAACAATTCCCTCTTTTTAGATTATCACAGGAATCCCTTTCCA
ATGTTTTTTGCCCGAGGCCTCAATGTTTCTCTTTCAACCGATGATCCCCTTCAGATACAT
TTGACAAAAGAGCCTCTTGTTGAGGAGTACAGCATAGCTGCACA
■■Homology search results ■■ -
sp_hit_id Q84NP7
Definition sp|Q84NP7|AMPD_ORYSJ Probable AMP deaminase OS=Oryza sativa subsp. japonica
Align length 154
Score (bit) 235.0
E-value 6.0e-62
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913700|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_C09.
(464 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q84NP7|AMPD_ORYSJ Probable AMP deaminase OS=Oryza sativa subs... 235 6e-62
sp|O80452|AMPD_ARATH AMP deaminase OS=Arabidopsis thaliana GN=AM... 234 1e-61
sp|Q54DD0|AMPD_DICDI AMP deaminase OS=Dictyostelium discoideum G... 194 1e-49
sp|P15274|AMPD_YEAST AMP deaminase OS=Saccharomyces cerevisiae G... 165 8e-41
sp|Q9DBT5|AMPD2_MOUSE AMP deaminase 2 OS=Mus musculus GN=Ampd2 P... 165 8e-41
sp|Q01433|AMPD2_HUMAN AMP deaminase 2 OS=Homo sapiens GN=AMPD2 P... 165 8e-41
sp|P50998|AMPD_SCHPO AMP deaminase OS=Schizosaccharomyces pombe ... 164 2e-40
sp|Q3V1D3|AMPD1_MOUSE AMP deaminase 1 OS=Mus musculus GN=Ampd1 P... 157 3e-38
sp|P10759|AMPD1_RAT AMP deaminase 1 OS=Rattus norvegicus GN=Ampd... 156 5e-38
sp|P23109|AMPD1_HUMAN AMP deaminase 1 OS=Homo sapiens GN=AMPD1 P... 156 5e-38
sp|O09178|AMPD3_RAT AMP deaminase 3 OS=Rattus norvegicus GN=Ampd... 154 2e-37
sp|Q01432|AMPD3_HUMAN AMP deaminase 3 OS=Homo sapiens GN=AMPD3 P... 153 3e-37
sp|O08739|AMPD3_MOUSE AMP deaminase 3 OS=Mus musculus GN=Ampd3 P... 152 9e-37
sp|Q02356|AMPD2_RAT AMP deaminase 2 (Fragment) OS=Rattus norvegi... 133 3e-31
sp|P38150|YB9Z_YEAST Uncharacterized deaminase YBR284W OS=Saccha... 55 2e-07
sp|Q11C48|ADD_MESSB Adenosine deaminase OS=Mesorhizobium sp. (st... 47 4e-05
sp|Q5NNW5|ADD_ZYMMO Adenosine deaminase OS=Zymomonas mobilis GN=... 45 2e-04
sp|Q97EV1|ADD_CLOAB Adenosine deaminase OS=Clostridium acetobuty... 43 8e-04
sp|P40361|YJH0_YEAST Uncharacterized deaminase YJL070C OS=Saccha... 42 0.001
sp|A1RDZ6|ADD_SHESW Adenosine deaminase OS=Shewanella sp. (strai... 40 0.004
sp|A4YCD7|ADD_SHEPC Adenosine deaminase OS=Shewanella putrefacie... 40 0.004
sp|Q20YN2|ADD_RHOPB Adenosine deaminase OS=Rhodopseudomonas palu... 40 0.006
sp|Q0HD92|ADD_SHESM Adenosine deaminase OS=Shewanella sp. (strai... 39 0.008
sp|A0L2R5|ADD_SHESA Adenosine deaminase OS=Shewanella sp. (strai... 39 0.008
sp|Q0HPH4|ADD_SHESR Adenosine deaminase OS=Shewanella sp. (strai... 39 0.011
sp|A6WUH7|ADD_SHEB8 Adenosine deaminase OS=Shewanella baltica (s... 39 0.014
sp|Q08A11|ADD_SHEFN Adenosine deaminase OS=Shewanella frigidimar... 38 0.019
sp|P58780|CECR1_PIG Cat eye syndrome critical region protein 1 h... 38 0.024
sp|Q8E8D4|ADD_SHEON Adenosine deaminase OS=Shewanella oneidensis... 38 0.024
sp|A9KWZ3|ADD_SHEB9 Adenosine deaminase OS=Shewanella baltica (s... 38 0.024

>sp|Q84NP7|AMPD_ORYSJ Probable AMP deaminase OS=Oryza sativa subsp.
japonica GN=AMPD PE=2 SV=1
Length = 815

Score = 235 bits (600), Expect = 6e-62
Identities = 116/154 (75%), Positives = 122/154 (79%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHMP+P W LYTLNKLRESKGM+ IK RPH GE
Sbjct: 579 ESKPERRPTKHMPTPEQWTNVFNPAYAYYVYYCYANLYTLNKLRESKGMTTIKLRPHCGE 638

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL A F+ SHNIAHG NL+KSP LQYLYYLAQIGL MSPLSNNSLF+DYHRNPFP
Sbjct: 639 AGDIDHLAAAFLTSHNIAHGVNLKKSPVLQYLYYLAQIGLAMSPLSNNSLFIDYHRNPFP 698

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
FF RGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 699 TFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 732


>sp|O80452|AMPD_ARATH AMP deaminase OS=Arabidopsis thaliana GN=AMPD
PE=1 SV=2
Length = 839

Score = 234 bits (598), Expect = 1e-61
Identities = 116/154 (75%), Positives = 122/154 (79%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHMP+P W LY LNKLRESKGM+ I RPHSGE
Sbjct: 603 ESKPERRPTKHMPTPAQWTNAFNPAFSYYVYYCYANLYVLNKLRESKGMTTITLRPHSGE 662

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL ATF+ H+IAHG NLRKSP LQYLYYLAQIGL MSPLSNNSLFLDYHRNPFP
Sbjct: 663 AGDIDHLAATFLTCHSIAHGINLRKSPVLQYLYYLAQIGLAMSPLSNNSLFLDYHRNPFP 722

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
+FF RGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 723 VFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 756


>sp|Q54DD0|AMPD_DICDI AMP deaminase OS=Dictyostelium discoideum
GN=amdA PE=1 SV=1
Length = 790

Score = 194 bits (494), Expect = 1e-49
Identities = 96/153 (62%), Positives = 111/153 (72%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESK E++ T+ P P W+ LYTLN+ RE KG++I+ RPHSGE
Sbjct: 432 ESKFEKKFTEKFPVPGEWSSEHNPPYTYYLYYLYANLYTLNQFREEKGLNILTLRPHSGE 491

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AGE DH+ A F L+H I HG NLRK+P LQYLYYL QIG+ MSPLSNNSLFL Y+RNPFP
Sbjct: 492 AGEVDHMGAAFYLAHGINHGINLRKTPVLQYLYYLTQIGIAMSPLSNNSLFLTYNRNPFP 551

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIA 459
FFARGLNVS+STDDPLQ H TKEPL+EEYSIA
Sbjct: 552 AFFARGLNVSISTDDPLQFHYTKEPLMEEYSIA 584


>sp|P15274|AMPD_YEAST AMP deaminase OS=Saccharomyces cerevisiae
GN=AMD1 PE=1 SV=2
Length = 810

Score = 165 bits (418), Expect = 8e-41
Identities = 79/154 (51%), Positives = 103/154 (66%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESK +RR + P P W + +LN+ R +G + + RPH GE
Sbjct: 574 ESKVDRRFHRKYPKPSLWEAPQNPPYSYYLYYLYSNVASLNQWRAKRGFNTLVLRPHCGE 633

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ +HLV+ ++L+H I+HG LRK P +QYLYYL Q+G+ MSPLSNN+LFL Y +NPFP
Sbjct: 634 AGDPEHLVSAYLLAHGISHGILLRKVPFVQYLYYLDQVGIAMSPLSNNALFLTYDKNPFP 693

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
+F RGLNVSLSTDDPLQ T+EPL+EEYS+AA
Sbjct: 694 RYFKRGLNVSLSTDDPLQFSYTREPLIEEYSVAA 727


>sp|Q9DBT5|AMPD2_MOUSE AMP deaminase 2 OS=Mus musculus GN=Ampd2 PE=1
SV=1
Length = 798

Score = 165 bits (418), Expect = 8e-41
Identities = 87/154 (56%), Positives = 98/154 (63%), Gaps = 1/154 (0%)
Frame = +1

Query: 1 ESKPERRPTK-HMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSG 177
ESKPE P P AW + LN LR +G RPH G
Sbjct: 550 ESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCG 609

Query: 178 EAGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPF 357
EAG HLV+ F+L+ NI+HG LRK+P LQYLYYLAQIG+ MSPLSNNSLFL YHRNP
Sbjct: 610 EAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPL 669

Query: 358 PMFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIA 459
P + +RGL VSLSTDDPLQ H TKEPL+EEYSIA
Sbjct: 670 PEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIA 703


>sp|Q01433|AMPD2_HUMAN AMP deaminase 2 OS=Homo sapiens GN=AMPD2 PE=1
SV=2
Length = 879

Score = 165 bits (418), Expect = 8e-41
Identities = 87/154 (56%), Positives = 98/154 (63%), Gaps = 1/154 (0%)
Frame = +1

Query: 1 ESKPERRPTK-HMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSG 177
ESKPE P P AW + LN LR +G RPH G
Sbjct: 630 ESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCG 689

Query: 178 EAGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPF 357
EAG HLV+ F+L+ NI+HG LRK+P LQYLYYLAQIG+ MSPLSNNSLFL YHRNP
Sbjct: 690 EAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPL 749

Query: 358 PMFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIA 459
P + +RGL VSLSTDDPLQ H TKEPL+EEYSIA
Sbjct: 750 PEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIA 783


>sp|P50998|AMPD_SCHPO AMP deaminase OS=Schizosaccharomyces pombe
GN=ada1 PE=1 SV=2
Length = 846

Score = 164 bits (415), Expect = 2e-40
Identities = 82/154 (53%), Positives = 101/154 (65%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERR + P P W+I + +LN R+ +G + RPH GE
Sbjct: 546 ESKPERRTFRKFPYPKHWDINLNPPYSYWLYYMYANMTSLNSWRKIRGFNTFVLRPHCGE 605

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL + F+LSH I HG LRK P LQYL+YL QI + MSPLSNN+LFL Y +NPF
Sbjct: 606 AGDTDHLASAFLLSHGINHGILLRKVPFLQYLWYLDQIPIAMSPLSNNALFLAYDKNPFL 665

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
+F RGLNVSLSTDDPLQ T+EPL+EEY++AA
Sbjct: 666 TYFKRGLNVSLSTDDPLQFAFTREPLIEEYAVAA 699


>sp|Q3V1D3|AMPD1_MOUSE AMP deaminase 1 OS=Mus musculus GN=Ampd1 PE=2
SV=1
Length = 745

Score = 157 bits (396), Expect = 3e-38
Identities = 75/142 (52%), Positives = 96/142 (67%)
Frame = +1

Query: 37 PSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGEAGEQDHLVATFI 216
P P W + + LN LR+ +GM+ FRPH GEAG HL+ F+
Sbjct: 526 PKPEEWTMGNNPSYTYYAYYMYANITVLNSLRKERGMNTFLFRPHCGEAGALTHLMTAFM 585

Query: 217 LSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFPMFFARGLNVSLS 396
++ NI+HG NL+KSP LQYL++LAQI + MSPLSNNSLFL+Y +NPF F +GL +SLS
Sbjct: 586 IADNISHGLNLKKSPVLQYLFFLAQIPIAMSPLSNNSLFLEYAKNPFLDFLQKGLMISLS 645

Query: 397 TDDPLQIHLTKEPLVEEYSIAA 462
TDDP+Q H TKEPL+EEY+IAA
Sbjct: 646 TDDPMQFHFTKEPLMEEYAIAA 667


>sp|P10759|AMPD1_RAT AMP deaminase 1 OS=Rattus norvegicus GN=Ampd1
PE=1 SV=1
Length = 747

Score = 156 bits (394), Expect = 5e-38
Identities = 75/142 (52%), Positives = 96/142 (67%)
Frame = +1

Query: 37 PSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGEAGEQDHLVATFI 216
P P W + + LN LR+ +GM+ FRPH GEAG HL+ F+
Sbjct: 528 PKPEEWTMENNPSYTYYAYYMYANIMVLNCLRKERGMNTFLFRPHCGEAGALTHLMTAFM 587

Query: 217 LSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFPMFFARGLNVSLS 396
++ NI+HG NL+KSP LQYL++LAQI + MSPLSNNSLFL+Y +NPF F +GL +SLS
Sbjct: 588 IADNISHGLNLKKSPVLQYLFFLAQIPIAMSPLSNNSLFLEYAKNPFLDFLQKGLMISLS 647

Query: 397 TDDPLQIHLTKEPLVEEYSIAA 462
TDDP+Q H TKEPL+EEY+IAA
Sbjct: 648 TDDPMQFHFTKEPLMEEYAIAA 669


>sp|P23109|AMPD1_HUMAN AMP deaminase 1 OS=Homo sapiens GN=AMPD1 PE=1
SV=1
Length = 747

Score = 156 bits (394), Expect = 5e-38
Identities = 74/142 (52%), Positives = 96/142 (67%)
Frame = +1

Query: 37 PSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGEAGEQDHLVATFI 216
P P W + + LN LR+ +GM+ FRPH GEAG HL+ F+
Sbjct: 528 PKPQEWTLEKNPSYTYYAYYMYANIMVLNSLRKERGMNTFLFRPHCGEAGALTHLMTAFM 587

Query: 217 LSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFPMFFARGLNVSLS 396
++ +I+HG NL+KSP LQYL++LAQI + MSPLSNNSLFL+Y +NPF F +GL +SLS
Sbjct: 588 IADDISHGLNLKKSPVLQYLFFLAQIPIAMSPLSNNSLFLEYAKNPFLDFLQKGLMISLS 647

Query: 397 TDDPLQIHLTKEPLVEEYSIAA 462
TDDP+Q H TKEPL+EEY+IAA
Sbjct: 648 TDDPMQFHFTKEPLMEEYAIAA 669


tr_hit_id A7QHP0
Definition tr|A7QHP0|A7QHP0_VITVI Chromosome chr8 scaffold_99, whole genome shotgun sequence OS=Vitis vinifera
Align length 154
Score (bit) 247.0
E-value 2.0e-64
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913700|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_C09.
(464 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QHP0|A7QHP0_VITVI Chromosome chr8 scaffold_99, whole genome... 247 2e-64
tr|A9TSQ4|A9TSQ4_PHYPA Predicted protein (Fragment) OS=Physcomit... 243 3e-63
tr|Q5W647|Q5W647_ORYSJ Putative uncharacterized protein OSJNBb00... 242 8e-63
tr|Q0DIZ0|Q0DIZ0_ORYSJ Os05g0349200 protein (Fragment) OS=Oryza ... 242 8e-63
tr|A9T5H8|A9T5H8_PHYPA Predicted protein (Fragment) OS=Physcomit... 241 1e-62
tr|A9SGR7|A9SGR7_PHYPA Predicted protein OS=Physcomitrella paten... 240 2e-62
tr|Q0D3C9|Q0D3C9_ORYSJ Os07g0693500 protein OS=Oryza sativa subs... 235 7e-61
tr|A2YQ78|A2YQ78_ORYSI Putative uncharacterized protein OS=Oryza... 235 7e-61
tr|A7Q2Q2|A7Q2Q2_VITVI Chromosome chr1 scaffold_46, whole genome... 231 2e-59
tr|A8IVW3|A8IVW3_CHLRE Predicted protein (Fragment) OS=Chlamydom... 224 2e-57
tr|A4RTJ6|A4RTJ6_OSTLU Predicted protein OS=Ostreococcus lucimar... 216 4e-55
tr|Q01DN7|Q01DN7_OSTTA P0034A04.129 gene product (ISS) OS=Ostreo... 214 2e-54
tr|A5C510|A5C510_VITVI Putative uncharacterized protein OS=Vitis... 191 2e-47
tr|A8NQX3|A8NQX3_COPC7 Putative uncharacterized protein OS=Copri... 176 4e-43
tr|Q4P5J1|Q4P5J1_USTMA Putative uncharacterized protein OS=Ustil... 174 3e-42
tr|B3SCI1|B3SCI1_TRIAD Putative uncharacterized protein OS=Trich... 172 7e-42
tr|B6N2I1|B6N2I1_BRAFL Putative uncharacterized protein OS=Branc... 171 2e-41
tr|B6MU43|B6MU43_BRAFL Putative uncharacterized protein OS=Branc... 170 3e-41
tr|B3MZS4|B3MZS4_DROAN GF19072 OS=Drosophila ananassae GN=GF1907... 170 4e-41
tr|B5DN26|B5DN26_DROPS GA22533 OS=Drosophila pseudoobscura pseud... 169 6e-41
tr|B4H0L9|B4H0L9_DROPE GL15010 OS=Drosophila persimilis GN=GL150... 169 6e-41
tr|A8QDB5|A8QDB5_MALGO Putative uncharacterized protein OS=Malas... 168 1e-40
tr|B8JIS9|B8JIS9_DANRE Adenosine monophosphate deaminase 2 (Isof... 168 1e-40
tr|Q9VY76|Q9VY76_DROME CG32626, isoform A OS=Drosophila melanoga... 168 1e-40
tr|Q961Q7|Q961Q7_DROME CG32626, isoform C OS=Drosophila melanoga... 168 1e-40
tr|Q76NR0|Q76NR0_DROME CG32626, isoform D OS=Drosophila melanoga... 168 1e-40
tr|Q76NQ9|Q76NQ9_DROME CG32626, isoform B OS=Drosophila melanoga... 168 1e-40
tr|B4Q2H0|B4Q2H0_DROYA GE16134 OS=Drosophila yakuba GN=GE16134 P... 168 1e-40
tr|A9VAP0|A9VAP0_MONBE Predicted protein OS=Monosiga brevicollis... 168 1e-40
tr|Q0C7D2|Q0C7D2_ASPTN AMP deaminase OS=Aspergillus terreus (str... 168 1e-40

>tr|A7QHP0|A7QHP0_VITVI Chromosome chr8 scaffold_99, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038865001
PE=4 SV=1
Length = 825

Score = 247 bits (631), Expect = 2e-64
Identities = 122/154 (79%), Positives = 126/154 (81%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHMP+P W LYTLNKLRESKGM+ IKFRPHSGE
Sbjct: 589 ESKPERRPTKHMPTPAQWTNAFNPAFSYYVYYCYANLYTLNKLRESKGMTTIKFRPHSGE 648

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL ATF+ SHNIAHG NLRKSP LQYLYYLAQIGL MSPLSNNSLFLDYHRNPFP
Sbjct: 649 AGDTDHLAATFLTSHNIAHGINLRKSPVLQYLYYLAQIGLAMSPLSNNSLFLDYHRNPFP 708

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
MFF RGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 709 MFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 742


>tr|A9TSQ4|A9TSQ4_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_149960 PE=4 SV=1
Length = 725

Score = 243 bits (620), Expect = 3e-63
Identities = 117/154 (75%), Positives = 127/154 (82%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHM +P WN L+ LNKLRESKGM++I+FRPHSGE
Sbjct: 488 ESKPERRPTKHMQTPAEWNNPFNPAYSYWAYYVYANLHVLNKLRESKGMTVIRFRPHSGE 547

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL ATF+++HNIAHGNNLRKSP LQYLYYLAQ+GL MSPLSNNSLFLDYHRNPFP
Sbjct: 548 AGDLDHLAATFMVAHNIAHGNNLRKSPGLQYLYYLAQVGLSMSPLSNNSLFLDYHRNPFP 607

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
MFFARGLNV LSTDDPLQIHLTKEPLVEEY IAA
Sbjct: 608 MFFARGLNVCLSTDDPLQIHLTKEPLVEEYGIAA 641


>tr|Q5W647|Q5W647_ORYSJ Putative uncharacterized protein
OSJNBb0052F16.15 OS=Oryza sativa subsp. japonica
GN=OSJNBb0052F16.15 PE=4 SV=1
Length = 331

Score = 242 bits (617), Expect = 8e-63
Identities = 119/154 (77%), Positives = 125/154 (81%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHMP+P W LYTLNKLRESKGM+ IKFRPH+GE
Sbjct: 95 ESKPERRPTKHMPTPEQWTNVFNPAFSYYAYYCYANLYTLNKLRESKGMTTIKFRPHAGE 154

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL ATF+L HNI+HG NLRKSP LQYLYYL QIGL MSPLSNNSLFLDYHRNPFP
Sbjct: 155 AGDIDHLAATFLLCHNISHGINLRKSPVLQYLYYLGQIGLAMSPLSNNSLFLDYHRNPFP 214

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
MFF RGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 215 MFFQRGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 248


>tr|Q0DIZ0|Q0DIZ0_ORYSJ Os05g0349200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os05g0349200 PE=4 SV=1
Length = 397

Score = 242 bits (617), Expect = 8e-63
Identities = 119/154 (77%), Positives = 125/154 (81%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHMP+P W LYTLNKLRESKGM+ IKFRPH+GE
Sbjct: 161 ESKPERRPTKHMPTPEQWTNVFNPAFSYYAYYCYANLYTLNKLRESKGMTTIKFRPHAGE 220

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL ATF+L HNI+HG NLRKSP LQYLYYL QIGL MSPLSNNSLFLDYHRNPFP
Sbjct: 221 AGDIDHLAATFLLCHNISHGINLRKSPVLQYLYYLGQIGLAMSPLSNNSLFLDYHRNPFP 280

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
MFF RGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 281 MFFQRGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 314


>tr|A9T5H8|A9T5H8_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_140536 PE=4 SV=1
Length = 649

Score = 241 bits (616), Expect = 1e-62
Identities = 117/154 (75%), Positives = 126/154 (81%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHM P W+ LYTLNKLRESKG IKFRPH+GE
Sbjct: 413 ESKPERRPTKHMQPPAKWDNPFNPAYSYWAYYVYANLYTLNKLRESKGFPTIKFRPHTGE 472

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL A+F+++HNIAHGNNLRK+P LQYLYYLAQIGL MSPLSNNSLFLDYHRNPFP
Sbjct: 473 AGDSDHLAASFLVAHNIAHGNNLRKTPGLQYLYYLAQIGLAMSPLSNNSLFLDYHRNPFP 532

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
MFF+RGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 533 MFFSRGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 566


>tr|A9SGR7|A9SGR7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_212161 PE=4 SV=1
Length = 655

Score = 240 bits (613), Expect = 2e-62
Identities = 117/154 (75%), Positives = 126/154 (81%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHM P W+ LY LNKLRESK +S IKFRPH+GE
Sbjct: 419 ESKPERRPTKHMQPPAKWDNPFNPAYSYWAYYVYANLYVLNKLRESKNLSTIKFRPHTGE 478

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL A+F+++HNIAHGNNLRK+P LQYLYYLAQIGL MSPLSNNSLFLDYHRNPFP
Sbjct: 479 AGDLDHLAASFLVAHNIAHGNNLRKTPGLQYLYYLAQIGLAMSPLSNNSLFLDYHRNPFP 538

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 539 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 572


>tr|Q0D3C9|Q0D3C9_ORYSJ Os07g0693500 protein OS=Oryza sativa subsp.
japonica GN=Os07g0693500 PE=4 SV=1
Length = 815

Score = 235 bits (600), Expect = 7e-61
Identities = 116/154 (75%), Positives = 122/154 (79%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHMP+P W LYTLNKLRESKGM+ IK RPH GE
Sbjct: 579 ESKPERRPTKHMPTPEQWTNVFNPAYAYYVYYCYANLYTLNKLRESKGMTTIKLRPHCGE 638

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL A F+ SHNIAHG NL+KSP LQYLYYLAQIGL MSPLSNNSLF+DYHRNPFP
Sbjct: 639 AGDIDHLAAAFLTSHNIAHGVNLKKSPVLQYLYYLAQIGLAMSPLSNNSLFIDYHRNPFP 698

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
FF RGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 699 TFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 732


>tr|A2YQ78|A2YQ78_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_27440 PE=4 SV=1
Length = 815

Score = 235 bits (600), Expect = 7e-61
Identities = 116/154 (75%), Positives = 122/154 (79%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHMP+P W LYTLNKLRESKGM+ IK RPH GE
Sbjct: 579 ESKPERRPTKHMPTPEQWTNVFNPAYAYYVYYCYANLYTLNKLRESKGMTTIKLRPHCGE 638

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL A F+ SHNIAHG NL+KSP LQYLYYLAQIGL MSPLSNNSLF+DYHRNPFP
Sbjct: 639 AGDIDHLAAAFLTSHNIAHGVNLKKSPVLQYLYYLAQIGLAMSPLSNNSLFIDYHRNPFP 698

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
FF RGLNVSLSTDDPLQIHLTKEPLVEEYSIAA
Sbjct: 699 TFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 732


>tr|A7Q2Q2|A7Q2Q2_VITVI Chromosome chr1 scaffold_46, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028972001
PE=4 SV=1
Length = 509

Score = 231 bits (588), Expect = 2e-59
Identities = 113/154 (73%), Positives = 121/154 (78%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKHMP+P W LYTLNKLRESKG+ IKFRPH GE
Sbjct: 272 ESKPERRPTKHMPTPAEWTNEFNPAYSYYAYYCYANLYTLNKLRESKGLPTIKFRPHCGE 331

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHL A F+L HNI+HG NLRKSP LQYLYYLAQ+GL MSPLSNNSLFLDY RNPFP
Sbjct: 332 AGDVDHLAAAFLLCHNISHGINLRKSPVLQYLYYLAQVGLAMSPLSNNSLFLDYGRNPFP 391

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
MFF RGLNVSLS+DDPLQIHLTKE LVEEYS+AA
Sbjct: 392 MFFQRGLNVSLSSDDPLQIHLTKEALVEEYSVAA 425


>tr|A8IVW3|A8IVW3_CHLRE Predicted protein (Fragment)
OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_102200 PE=4
SV=1
Length = 592

Score = 224 bits (570), Expect = 2e-57
Identities = 108/154 (70%), Positives = 120/154 (77%)
Frame = +1

Query: 1 ESKPERRPTKHMPSPLAWNIXXXXXXXXXXXXXXXXLYTLNKLRESKGMSIIKFRPHSGE 180
ESKPERRPTKH P WN LY LNK RES+G++ FRPH+GE
Sbjct: 371 ESKPERRPTKHSEPPERWNTKHNCAYAYYAYYIYANLYVLNKFRESRGLNTFTFRPHAGE 430

Query: 181 AGEQDHLVATFILSHNIAHGNNLRKSPALQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 360
AG+ DHLVA F+L NIAHG NLRK+P +QYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP
Sbjct: 431 AGDIDHLVAGFMLCENIAHGINLRKNPCVQYLYYLAQIGLCMSPLSNNSLFLDYHRNPFP 490

Query: 361 MFFARGLNVSLSTDDPLQIHLTKEPLVEEYSIAA 462
+FFARGL+VSLSTDDP+ IHLTKEPLVEEYS+AA
Sbjct: 491 LFFARGLSVSLSTDDPVMIHLTKEPLVEEYSVAA 524