BP913701
Clone id YMU001_000033_C10
Library
Length 559
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000033_C10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTTTTTCCTGCCAAAGACACAATTCCATCGATTTTCATATCAAAGCCAAA
AGGTACATAATTCAACTTGCAATGAGTATGCAAGGTGCAAGCCCAAGTACAAAGAGTCCA
AGACATATAAATATGCAGGCTGTAGGAGCATATCAAAGCCAAAAGGTACATAATTCAACT
TGCAATGAGTATGCAAGGTGCAAGCCCAAGACATATAAATATGCAGGCTGTAGGATGTAC
ATGGGATGTTCAAGCTTAAGCTTATTAACAATAGTTAAGACTGTACATTTATACATGGGA
TAGAAGAGGTATAATTACATTTACATGATGACCCTGACAAGACATTAGTACCAACAACAG
GCTGCTGCCGGGTAACTTGTTGGTTATGAATACCAGTCAAAAAGTTTCGAAACAGAGCTT
CATATCAGCTTGCATCTTGGCATTGCATTTCCCTGTCGGAGGTTTCACCTATTGCATATT
ACCATATACTATGGACATTCAATAAGGTGATAAAACTAAGCATCAGCCCTTATTATCTCA
AATGTCCACGCTAATTCGC
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913701|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_C10.
(543 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A2DRG6
Definition tr|A2DRG6|A2DRG6_TRIVA Putative uncharacterized protein OS=Trichomonas vaginalis G3
Align length 37
Score (bit) 33.1
E-value 9.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913701|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_C10.
(543 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2DRG6|A2DRG6_TRIVA Putative uncharacterized protein OS=Trich... 33 9.7

>tr|A2DRG6|A2DRG6_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_280450 PE=4 SV=1
Length = 472

Score = 33.1 bits (74), Expect = 9.7
Identities = 16/37 (43%), Positives = 19/37 (51%)
Frame = -2

Query: 149 LLALICSYSLHIYMSWTLCTWACTLHTHCKLNYVPFG 39
L+ L C++S Y T C WAC CK NY FG
Sbjct: 268 LICLACTFSNRCYR--TGCRWACCFFCCCKGNYTLFG 302