BP913712
Clone id YMU001_000033_D10
Library
Length 526
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000033_D10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTGTATTTTTTTTTTTTTTCAAAATACAAAATCAGCTAATTACAGTAAACATAAAACTA
TCTCCTTCCTTGAAAGAGGTTGTACATGGTGTCTTCCAATTTTCTTTACAAGTGAAAAAG
ATGCAAAAGCCGGCGACTTTCTGGCAGAAGTAGGCGATAAAGAGGAATGTCGCAGTATTG
CTTGCATCAAGCCAAATTGACATGCTGTATGATTCAACATGTGCGCTCCCAAGTTGCTCA
ATTTGAAAGACCAGGCATAGCACAGAGCTACCAAGGTTGCTTCTTACTCATAACTTCACA
TGGGTGCAATTCTTGTGCCAGCACATTTTGCCCAGCATATCAATAACCAGTAGCAGACAA
CTTATTTTGCCCTGCGATCTACCAATATCCAAGTTCTTCATCTTCGAAATCCTCTCCCTC
ATCAGTATCTTCATAATCATCATCGTCATAATCATCCATTTCTTCTGTAGAATTCCTCTC
TTTGTCTCGGCCACTCACATCCACTACAAGTATCTTTGATCCTGTG
■■Homology search results ■■ -
sp_hit_id P39118
Definition sp|P39118|GLGB_BACSU 1,4-alpha-glucan-branching enzyme OS=Bacillus subtilis
Align length 52
Score (bit) 31.2
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913712|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_D10.
(506 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P39118|GLGB_BACSU 1,4-alpha-glucan-branching enzyme OS=Bacill... 31 2.9
sp|Q0KK59|K1409_MOUSE Uncharacterized protein KIAA1409 OS=Mus mu... 30 4.9
sp|Q9P2D8|K1409_HUMAN Uncharacterized protein KIAA1409 OS=Homo s... 30 4.9
sp|A8KBY2|BRF2_DANRE Transcription factor IIIB 50 kDa subunit OS... 30 8.4

>sp|P39118|GLGB_BACSU 1,4-alpha-glucan-branching enzyme OS=Bacillus
subtilis GN=glgB PE=2 SV=1
Length = 627

Score = 31.2 bits (69), Expect = 2.9
Identities = 16/52 (30%), Positives = 21/52 (40%)
Frame = -1

Query: 191 HTACQFGLMQAILRHSSLSPTSARKSPAFASFSLVKKIGRHHVQPLSRKEIV 36
H G M +L++ P R SFSL+ H V P S E+V
Sbjct: 372 HYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVV 423


>sp|Q0KK59|K1409_MOUSE Uncharacterized protein KIAA1409 OS=Mus
musculus GN=Kiaa1409 PE=1 SV=1
Length = 2596

Score = 30.4 bits (67), Expect = 4.9
Identities = 16/72 (22%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
Frame = +3

Query: 153 QYCLHQAKLTCCMIQHVRSQVAQFERPGIAQSYQGCFLLITSHG-CNSCASTFCPAYQ*P 329
++C Q +T +I + ++A+FE P I + C ++ HG C A P +
Sbjct: 943 KFCYQQLPVTLRLIYTIFQEMAKFEEPDILFNMLNCLKILCLHGECLYTARKDHPQFLAY 1002

Query: 330 VADNLFCPAIYQ 365
+ D++ ++++
Sbjct: 1003 IQDHMLIASLWR 1014


>sp|Q9P2D8|K1409_HUMAN Uncharacterized protein KIAA1409 OS=Homo
sapiens GN=KIAA1409 PE=2 SV=3
Length = 2635

Score = 30.4 bits (67), Expect = 4.9
Identities = 16/72 (22%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
Frame = +3

Query: 153 QYCLHQAKLTCCMIQHVRSQVAQFERPGIAQSYQGCFLLITSHG-CNSCASTFCPAYQ*P 329
++C Q +T +I + ++A+FE P I + C ++ HG C A P +
Sbjct: 943 KFCYQQLPVTLRLIYTIFQEMAKFEEPDILFNMLNCLKILCLHGECLYIARKDHPQFLAY 1002

Query: 330 VADNLFCPAIYQ 365
+ D++ ++++
Sbjct: 1003 IQDHMLIASLWR 1014


>sp|A8KBY2|BRF2_DANRE Transcription factor IIIB 50 kDa subunit
OS=Danio rerio GN=brf2 PE=2 SV=1
Length = 423

Score = 29.6 bits (65), Expect = 8.4
Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
Frame = -3

Query: 240 LCLVFQIEQLGSAHVESYSMSIWLDASNTATFLFIAYFCQKV-AGFCIFFTCKEN 79
LC +F++ S+ +E S +++ A N FL I+ +++ AG C+F C++N
Sbjct: 77 LCRIFRL----SSSMEDASANLFERAYNHPNFLHISLSKKQILAGCCMFHICRQN 127


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913712|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_D10.
(506 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******