BP913719
Clone id YMU001_000033_E05
Library
Length 450
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000033_E05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTGGCCAATTTAGCTTTCCCCTTGGACGATATTGCAGTAAACAAAATGTAAGTCTACA
CAACATTCCACAGAATGAATACTCGGAGAGCATCGTAACTGATACCCGTGACTTAAATGG
ACTAAGCATGTAACACCGGAAGTTCGACCTACTCAGCTACACATCTACAAGCTACTGCAT
CATCGATTCCCCAAGCTGGGGACCACAAAATTTAATGAAGAAAGAAGAGCCCACTACACG
GGGAAAAATTGAAGGCTCCACTCTGCCCACGACGTACTCATGAATACCTTGGATACCTAC
TCTGCCCATGGCGTGCTTATGAATATCTTTGAATACCTACTCTGCCCCGGATAAACATAC
TCGCTTTTGATACCAGCTCTGACATTGTAAGCTGTCTTCTAAAGCACCTTTGCATCTCCA
TAGCTTGCCTAGAACTCTCCAACGCTTAAA
■■Homology search results ■■ -
sp_hit_id A1BBD2
Definition sp|A1BBD2|DCTA_PARDP C4-dicarboxylate transport protein OS=Paracoccus denitrificans (strain Pd 1222)
Align length 103
Score (bit) 31.6
E-value 1.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913719|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_E05.
(450 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A1BBD2|DCTA_PARDP C4-dicarboxylate transport protein OS=Parac... 32 1.6
sp|Q90953|CSPG2_CHICK Versican core protein OS=Gallus gallus GN=... 30 4.7

>sp|A1BBD2|DCTA_PARDP C4-dicarboxylate transport protein
OS=Paracoccus denitrificans (strain Pd 1222) GN=dctA
PE=3 SV=1
Length = 455

Score = 31.6 bits (70), Expect = 1.6
Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 10/103 (9%)
Frame = +2

Query: 2 FGQFSFPLGRYCSKQNVSLHNIPQNEYSES------IVTDTRDLNGLSM*HRKFDLLSYT 163
FG F+F +G+Y V+L + Y S ++ LNG S+ F L+SY
Sbjct: 213 FGAFAFTIGKYGIASVVNLATLVGTFYLTSALFVIVVLGTVCMLNGFSI----FRLISYL 268

Query: 164 STSYCII----DSPSWGPQNLMKKEEPTTRGKIEGSTLPTTYS 280
++ S S P + K E+ + + G +PT YS
Sbjct: 269 KAEILLVLGTSSSESALPSLMEKMEKAGCKRSVVGLVVPTGYS 311


>sp|Q90953|CSPG2_CHICK Versican core protein OS=Gallus gallus GN=VCAN
PE=2 SV=1
Length = 3562

Score = 30.0 bits (66), Expect = 4.7
Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 4/74 (5%)
Frame = +2

Query: 65 IPQNEYSESIVTDT---RDLNGLSM*-HRKFDLLSYTSTSYCIIDSPSWGPQNLMKKEEP 232
+PQ E S+V T D+ + + H FD + +T + + P+ L K++
Sbjct: 1035 VPQREGDTSLVPVTVGSEDIGEMQVTDHTSFDSIIHTEATVTSTKASEVFPKELSTKDQD 1094

Query: 233 TTRGKIEGSTLPTT 274
G GSTLP T
Sbjct: 1095 RELGTAMGSTLPVT 1108


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913719|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_E05.
(450 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******