BP913727
Clone id YMU001_000033_F01
Library
Length 320
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000033_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGATGAGGGCCAAAAAGCAAAATTTCACTTCGCAAGCACACAGCCTCGCATGTTAAATAG
CTCTCCCGATAGCATTTCCTTGTGGATTACCAGTGTGTATGTTGGAGTCTATGATGCATC
CTGCTCATTCAAGCCAAACAGTCTATTCCAAGCTTTTGTGGAAACCCCTCAATCTCTTTG
AGATGCTTGACCACTTGCAACATGGTAGGGCGTCGCACTGGGTCATCAGACGTACAAAGA
GTGGCCACTTGAAGGGCCTGCATAGCCTTGACTTTCCATGCCCCATTGGACATGACCGCT
GCGTCGAGAACATCTGCTAC
■■Homology search results ■■ -
sp_hit_id Q9LYN8
Definition sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana
Align length 48
Score (bit) 42.0
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913727|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_F01.
(320 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase ... 42 0.001
sp|Q9LJF3|BRL3_ARATH Serine/threonine-protein kinase BRI1-like 3... 41 0.002
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Ar... 40 0.003
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1... 39 0.006
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvian... 37 0.030
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Sola... 37 0.030
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2... 36 0.067
sp|Q9FK10|Y5332_ARATH Probable inactive receptor kinase At5g5332... 35 0.15
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidops... 34 0.20
sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 ... 34 0.26
sp|O48788|Y2267_ARATH Probable inactive receptor kinase At2g2673... 33 0.57
sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re... 33 0.57
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidops... 32 0.75
sp|Q9LVM0|Y5830_ARATH Probable inactive receptor kinase At5g5830... 32 0.97
sp|O04567|Y1719_ARATH Probable inactive receptor kinase At1g2719... 32 0.97
sp|O64483|SIRK_ARATH Senescence-induced receptor-like serine/thr... 32 0.97
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis t... 32 1.3
sp|P18160|KYK1_DICDI Dual specificity protein kinase dpyk1 OS=Di... 32 1.3
sp|Q93Y06|Y5720_ARATH Probable inactive receptor kinase At5g6720... 31 2.2
sp|Q9C9Y8|Y3868_ARATH Probable inactive receptor kinase At3g0868... 31 2.2
sp|O48814|BIK1_ARATH Serine/threonine-protein kinase BIK1 OS=Ara... 31 2.2
sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx... 30 2.8
sp|Q9DA17|TSG13_MOUSE Testis-specific gene 13 protein OS=Mus mus... 30 4.8
sp|Q9LVI6|RLK90_ARATH Probable inactive receptor kinase RLK902 O... 30 4.8
sp|Q9FNE1|CRK42_ARATH Cysteine-rich receptor-like protein kinase... 30 4.8
sp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase... 30 4.8
sp|Q54U65|7TMK2_DICDI Seven transmembrane domain-containing seri... 30 4.8
sp|P50643|RIR1_SUHVK Ribonucleoside-diphosphate reductase large ... 29 6.3
sp|Q9CQ20|M1IP1_MOUSE Mid1-interacting protein 1 OS=Mus musculus... 29 6.3
sp|Q9M0G5|CRK43_ARATH Putative cysteine-rich receptor-like prote... 29 6.3

>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
OS=Arabidopsis thaliana GN=EXS PE=1 SV=1
Length = 1192

Score = 42.0 bits (97), Expect = 0.001
Identities = 22/48 (45%), Positives = 32/48 (66%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEI 171
DV+D ++S A K ++ LQ+A LC ++ P +RP ML V+K LKEI
Sbjct: 1146 DVIDPLLVSV-ALKNSQLRLLQIAMLCLAETPAKRPNMLDVLKALKEI 1192


>sp|Q9LJF3|BRL3_ARATH Serine/threonine-protein kinase BRI1-like 3
OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1
Length = 1164

Score = 41.2 bits (95), Expect = 0.002
Identities = 17/49 (34%), Positives = 33/49 (67%)
Frame = -1

Query: 317 ADVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEI 171
A++LD ++++ + V+ + L++A+ C D P +RPTM+QV+ KE+
Sbjct: 1087 AEILDPELVTDKSGDVELLHYLKIASQCLDDRPFKRPTMIQVMTMFKEL 1135


>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1
OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1
Length = 1196

Score = 40.4 bits (93), Expect = 0.003
Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
Frame = -1

Query: 320 VADVLDAAVMSNG-AWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
++DV D +M A +++ +Q L+VA C D RRPTM+QV+ KEI+
Sbjct: 1108 ISDVFDPELMKEDPALEIELLQHLKVAVACLDDRAWRRPTMVQVMAMFKEIQ 1159


>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1
OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1
Length = 1166

Score = 39.3 bits (90), Expect = 0.006
Identities = 16/50 (32%), Positives = 33/50 (66%)
Frame = -1

Query: 317 ADVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
A++LD ++++ + V+ L++A+ C D P +RPTM+Q++ KE++
Sbjct: 1089 AEILDPELVTDKSGDVELFHYLKIASQCLDDRPFKRPTMIQLMAMFKEMK 1138


>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum
PE=1 SV=1
Length = 1207

Score = 37.0 bits (84), Expect = 0.030
Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
Frame = -1

Query: 320 VADVLDAAVMSNGAW-KVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
+ DV D ++ A +++ +Q L+VA C D +RPTM+QV+ KEI+
Sbjct: 1113 ITDVFDRELLKEDASIEIELLQHLKVACACLDDRHWKRPTMIQVMAMFKEIQ 1164


>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum
lycopersicum GN=CURL3 PE=1 SV=1
Length = 1207

Score = 37.0 bits (84), Expect = 0.030
Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
Frame = -1

Query: 320 VADVLDAAVMSNGAW-KVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
+ DV D ++ A +++ +Q L+VA C D +RPTM+QV+ KEI+
Sbjct: 1113 ITDVFDRELLKEDASIEIELLQHLKVACACLDDRHWKRPTMIQVMAMFKEIQ 1164


>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2
OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1
Length = 1143

Score = 35.8 bits (81), Expect = 0.067
Identities = 15/33 (45%), Positives = 22/33 (66%)
Frame = -1

Query: 263 MQALQVATLCTSDDPVRRPTMLQVVKHLKEIEG 165
++ L++A C D P +RP MLQVV L+E+ G
Sbjct: 1099 LRYLEIALRCVDDFPSKRPNMLQVVASLRELRG 1131


>sp|Q9FK10|Y5332_ARATH Probable inactive receptor kinase At5g53320
OS=Arabidopsis thaliana GN=At5g53320 PE=1 SV=1
Length = 601

Score = 34.7 bits (78), Expect = 0.15
Identities = 18/55 (32%), Positives = 34/55 (61%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIEGFPQKL 150
+V D ++ + + ++ LQV +CT+ P +RP M++VV+ ++EI P+KL
Sbjct: 522 EVFDEELLRCTQVEEEMVEMLQVGMVCTARLPEKRPNMIEVVRMVEEIR--PEKL 574


>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis
thaliana GN=RCH2 PE=1 SV=1
Length = 1141

Score = 34.3 bits (77), Expect = 0.20
Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKV-KAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
+VLD+ + S + + MQ L A LC + P RPTM V LKEI+
Sbjct: 1018 EVLDSTLRSRTEAEADEMMQVLGTALLCVNSSPDERPTMKDVAAMLKEIK 1067


>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1
OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1
Length = 1095

Score = 33.9 bits (76), Expect = 0.26
Identities = 16/49 (32%), Positives = 29/49 (59%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
+V D + +G + ++ L +A +C + +P++RP + QVV LK IE
Sbjct: 1031 EVFDTLLRESGNEEAM-LRVLDIACMCVNQNPMKRPNIQQVVDWLKNIE 1078


tr_hit_id A7VM26
Definition tr|A7VM26|A7VM26_MARPO Receptor-like kinase (Fragment) OS=Marchantia polymorpha
Align length 58
Score (bit) 72.8
E-value 8.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913727|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_F01.
(320 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7VM26|A7VM26_MARPO Receptor-like kinase (Fragment) OS=Marcha... 73 8e-12
tr|A9TJD6|A9TJD6_PHYPA Predicted protein OS=Physcomitrella paten... 64 3e-09
tr|A9SBP9|A9SBP9_PHYPA CLL4B clavata1-like receptor S/T protein ... 64 4e-09
tr|A9SS32|A9SS32_PHYPA Predicted protein OS=Physcomitrella paten... 63 6e-09
tr|A9T6C8|A9T6C8_PHYPA Predicted protein OS=Physcomitrella paten... 59 9e-08
tr|A9S4Y2|A9S4Y2_PHYPA Predicted protein OS=Physcomitrella paten... 59 1e-07
tr|A9SDH6|A9SDH6_PHYPA CLL4A clavata1-like receptor S/T protein ... 55 1e-06
tr|A7Q9N1|A7Q9N1_VITVI Chromosome chr5 scaffold_67, whole genome... 47 6e-04
tr|A5BX07|A5BX07_VITVI Putative uncharacterized protein OS=Vitis... 47 6e-04
tr|B8A868|B8A868_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.001
tr|Q8RZV7|Q8RZV7_ORYSJ Putative extra sporogenous cells (Os01g09... 45 0.002
tr|A3A0X9|A3A0X9_ORYSJ Putative uncharacterized protein OS=Oryza... 45 0.002
tr|A7QVH5|A7QVH5_VITVI Chromosome chr16 scaffold_189, whole geno... 44 0.004
tr|A5BZW0|A5BZW0_VITVI Putative uncharacterized protein OS=Vitis... 44 0.004
tr|A5AJ32|A5AJ32_VITVI Putative uncharacterized protein (Chromos... 43 0.007
tr|Q76FZ8|Q76FZ8_PEA Brassinosteroid receptor OS=Pisum sativum G... 42 0.015
tr|B8LRM4|B8LRM4_PICSI Putative uncharacterized protein OS=Picea... 42 0.015
tr|B6D3U9|B6D3U9_PLAAC Kinase-like protein pac.BRI.L.6 (Fragment... 42 0.015
tr|Q7F8Q9|Q7F8Q9_ORYSJ Putative extra sporogenous cells (Putativ... 42 0.020
tr|Q0E346|Q0E346_ORYSJ Os02g0194400 protein (Fragment) OS=Oryza ... 42 0.020
tr|A9RER6|A9RER6_PHYPA CLL1B clavata1-like receptor S/T protein ... 42 0.020
tr|A7PKY8|A7PKY8_VITVI Chromosome chr7 scaffold_20, whole genome... 42 0.020
tr|A2X1Z2|A2X1Z2_ORYSI Putative uncharacterized protein OS=Oryza... 42 0.020
tr|Q84XU5|Q84XU5_ELAGV Receptor-like protein kinase (Fragment) O... 40 0.044
tr|Q0WRK5|Q0WRK5_ARATH Putative receptor-like protein kinase OS=... 40 0.044
tr|O22938|O22938_ARATH Putative receptor-like protein kinase OS=... 40 0.044
tr|A9RKR8|A9RKR8_PHYPA CLL1A clavata1-like receptor S/T protein ... 40 0.044
tr|A7QQF7|A7QQF7_VITVI Chromosome undetermined scaffold_142, who... 40 0.044
tr|Q6ZCZ2|Q6ZCZ2_ORYSJ Putative brassinosteroid receptor OS=Oryz... 40 0.058
tr|Q6H5Y1|Q6H5Y1_ORYSJ Os02g0228300 protein OS=Oryza sativa subs... 40 0.058

>tr|A7VM26|A7VM26_MARPO Receptor-like kinase (Fragment)
OS=Marchantia polymorpha GN=MpRLK10 PE=2 SV=1
Length = 581

Score = 72.8 bits (177), Expect = 8e-12
Identities = 34/58 (58%), Positives = 41/58 (70%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIEGFPQKLGID 141
DVLD + S G WK K + L VA+LCTS+DPV+RPTMLQVVK LK+IE Q G +
Sbjct: 521 DVLDPVICSGGPWKTKMLHVLHVASLCTSEDPVKRPTMLQVVKTLKDIEASQQVTGFE 578


>tr|A9TJD6|A9TJD6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_146487 PE=4 SV=1
Length = 1197

Score = 64.3 bits (155), Expect = 3e-09
Identities = 30/53 (56%), Positives = 40/53 (75%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIEGFPQ 156
+VLD V++NG WK K ++ L +A LCT++DP RRPTM QVVK LK++E PQ
Sbjct: 1139 NVLDP-VIANGPWKSKMLKVLHIANLCTTEDPARRPTMQQVVKMLKDVEAAPQ 1190


>tr|A9SBP9|A9SBP9_PHYPA CLL4B clavata1-like receptor S/T protein
kinase protein OS=Physcomitrella patens subsp. patens
GN=CLL4B PE=4 SV=1
Length = 1147

Score = 63.9 bits (154), Expect = 4e-09
Identities = 29/54 (53%), Positives = 42/54 (77%)
Frame = -1

Query: 317 ADVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIEGFPQ 156
A+ LD V++NG+WK K ++ L +A +CT++DPVRRPTM QVV+ LK++E PQ
Sbjct: 1088 AEALDP-VIANGSWKQKMLKVLHIADICTAEDPVRRPTMQQVVQMLKDVEAGPQ 1140


>tr|A9SS32|A9SS32_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_215125 PE=4 SV=1
Length = 1210

Score = 63.2 bits (152), Expect = 6e-09
Identities = 28/50 (56%), Positives = 41/50 (82%)
Frame = -1

Query: 317 ADVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
ADVLD ++S+G WK K ++ L +A +CT++DPV+RP+MLQVVK LK++E
Sbjct: 1150 ADVLDP-IVSDGPWKCKMLKVLHIANMCTAEDPVKRPSMLQVVKLLKDVE 1198


>tr|A9T6C8|A9T6C8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_140923 PE=4 SV=1
Length = 1213

Score = 59.3 bits (142), Expect = 9e-08
Identities = 27/53 (50%), Positives = 37/53 (69%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIEGFPQ 156
D LD V++NG WK ++ L +A CT++DP RRPTM QVVK L+++E PQ
Sbjct: 1155 DALDP-VIANGQWKSNMLKVLNIANQCTAEDPARRPTMQQVVKMLRDVEAAPQ 1206


>tr|A9S4Y2|A9S4Y2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_181347 PE=4 SV=1
Length = 1199

Score = 58.9 bits (141), Expect = 1e-07
Identities = 28/47 (59%), Positives = 36/47 (76%)
Frame = -1

Query: 308 LDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
LD+ V S G WK ++ L +A LCT++DP+RRPTMLQVVK LK+IE
Sbjct: 1149 LDSEV-SKGPWKNTMLKVLHIANLCTAEDPIRRPTMLQVVKFLKDIE 1194


>tr|A9SDH6|A9SDH6_PHYPA CLL4A clavata1-like receptor S/T protein
kinase protein OS=Physcomitrella patens subsp. patens
GN=CLL4A PE=4 SV=1
Length = 1247

Score = 55.5 bits (132), Expect = 1e-06
Identities = 27/49 (55%), Positives = 36/49 (73%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIE 168
+ LD V S G K+ ++ L +A LCT++DP+RRPTMLQVVK LK+IE
Sbjct: 1195 EALDPEV-SKGPCKLMMLKVLHIANLCTAEDPIRRPTMLQVVKFLKDIE 1242


>tr|A7Q9N1|A7Q9N1_VITVI Chromosome chr5 scaffold_67, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033550001
PE=4 SV=1
Length = 1291

Score = 46.6 bits (109), Expect = 6e-04
Identities = 23/48 (47%), Positives = 30/48 (62%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEI 171
+VLD + + WK + + L A CT DDP RRPTM++VVK L EI
Sbjct: 1239 EVLDPYLSAMTMWKDEMLHVLSTARWCTLDDPWRRPTMVEVVKLLMEI 1286


>tr|A5BX07|A5BX07_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_038451 PE=4 SV=1
Length = 1291

Score = 46.6 bits (109), Expect = 6e-04
Identities = 23/48 (47%), Positives = 30/48 (62%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEI 171
+VLD + + WK + + L A CT DDP RRPTM++VVK L EI
Sbjct: 1239 EVLDPYLSAMTMWKDEMLHVLSTARWCTLDDPWRRPTMVEVVKLLMEI 1286


>tr|B8A868|B8A868_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_04936 PE=4 SV=1
Length = 786

Score = 45.4 bits (106), Expect = 0.001
Identities = 19/50 (38%), Positives = 32/50 (64%)
Frame = -1

Query: 314 DVLDAAVMSNGAWKVKAMQALQVATLCTSDDPVRRPTMLQVVKHLKEIEG 165
++ D + + W+ + ++ L +A CT+D+P +RPTML+VVK LK G
Sbjct: 723 ELFDPCLPVSSVWREQMVRVLAIARDCTADEPFKRPTMLEVVKGLKMTHG 772