BP913728
Clone id YMU001_000033_F02
Library
Length 596
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000033_F02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CACACACACAACTGCCCCTATATAGCTCAGGGTATTCACAGCACCCCTGTCCTCTCGAAA
ACACCTTCAAAAAAGACTATTCACACTAGGAGGGCCTCGCCTGCACTTCGCCCAACGCAC
ACACAACCTGCACAATTGCTAGAGAGCGATTACACCAATCTTGCCCGCTTCCAGCTCTTC
CACATCTCGACACCTCTCTCTCTTTCTCTCTCACACACACAGGGGCCCCGGGGGACGCAC
ACGCTCACACACACCGGCACCACACACCTTGGAGACGAGCAAAGAAGAAAGGGAGAAAGG
GAGGAAAGACGACGCCAAAATCGACAATGACAGCTTCTCTTTCAAACCAGAAACCATGTA
CAAACTCCATGAACCGTGCTCAAGGCTACGCCATGGCCATCGCCGCTTCATACAGAGGGG
CACACACCTCCCTCGACAAACCGAATCCGTCGACACACGCCTCGACGGGAAGATTCACCT
CTAGCTTCGCATCGACGACAACTTTGGCTCTTGATAGCTTTCTCTAGCTTCTTCTCCTGC
AGAGCTCGTGCCCTTCCAAGCTTTTTTACGGACCATGCATCGCGATGCCGAGCGCA
■■Homology search results ■■ -
sp_hit_id P21614
Definition sp|P21614|VTDB_MOUSE Vitamin D-binding protein OS=Mus musculus
Align length 44
Score (bit) 33.5
E-value 0.83
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913728|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_F02.
(596 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P21614|VTDB_MOUSE Vitamin D-binding protein OS=Mus musculus G... 33 0.83
sp|Q74Z37|SEF1_ASHGO Putative transcription factor SEF1 OS=Ashby... 33 1.1
sp|P53789|VTDB_RABIT Vitamin D-binding protein OS=Oryctolagus cu... 32 3.2
sp|Q8TGJ7|YL66B_YEAST Uncharacterized protein YLL066W-B OS=Sacch... 31 4.1
sp|P04276|VTDB_RAT Vitamin D-binding protein OS=Rattus norvegicu... 31 5.4
sp|O14960|LECT2_HUMAN Leukocyte cell-derived chemotaxin-2 OS=Hom... 30 7.1
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryot... 30 9.2
sp|Q9P7I3|MDV1_SCHPO Mitochondrial division protein 1 OS=Schizos... 30 9.2
sp|A2QVS9|MCES_ASPNC mRNA cap guanine-N7 methyltransferase OS=As... 30 9.2

>sp|P21614|VTDB_MOUSE Vitamin D-binding protein OS=Mus musculus
GN=Gc PE=1 SV=2
Length = 476

Score = 33.5 bits (75), Expect = 0.83
Identities = 20/44 (45%), Positives = 24/44 (54%)
Frame = +3

Query: 21 YSSGYSQHPCPLENTFKKDYSH*EGLACTSPNAHTTCTIARERL 152
YSS Y Q P PL + K+Y G CTS N T C + +ERL
Sbjct: 163 YSSNYGQAPLPLLVAYTKNYLSMVGSCCTSANP-TVCFV-KERL 204


>sp|Q74Z37|SEF1_ASHGO Putative transcription factor SEF1 OS=Ashbya
gossypii GN=SEF1 PE=3 SV=1
Length = 1051

Score = 33.1 bits (74), Expect = 1.1
Identities = 20/65 (30%), Positives = 27/65 (41%)
Frame = +1

Query: 4 THNCPYIAQGIHSTPVLSKTPSKKTIHTRRASPALRPTHTQPAQLLESDYTNLARFQLFH 183
+HN P H+TP+LS K + T A P LL S Y N+ F L
Sbjct: 265 SHNTPIDTPSSHTTPMLSPEVKKPVVATTNAMP-----------LLPSPYANIDEFVLGD 313

Query: 184 ISTPL 198
+ P+
Sbjct: 314 VHIPI 318


>sp|P53789|VTDB_RABIT Vitamin D-binding protein OS=Oryctolagus
cuniculus GN=GC PE=2 SV=1
Length = 476

Score = 31.6 bits (70), Expect = 3.2
Identities = 18/44 (40%), Positives = 22/44 (50%)
Frame = +3

Query: 21 YSSGYSQHPCPLENTFKKDYSH*EGLACTSPNAHTTCTIARERL 152
YSS Y Q P P+ ++ K Y G CTS A T +ERL
Sbjct: 163 YSSNYGQAPLPILVSYTKSYLSMVGTCCTS--ASPTVCFLKERL 204


>sp|Q8TGJ7|YL66B_YEAST Uncharacterized protein YLL066W-B
OS=Saccharomyces cerevisiae GN=YLL066W-B PE=4 SV=1
Length = 56

Score = 31.2 bits (69), Expect = 4.1
Identities = 11/18 (61%), Positives = 11/18 (61%)
Frame = +3

Query: 216 HTGAPGDAHAHTHRHHTP 269
HT P H HTH HHTP
Sbjct: 21 HTHTPHPHHTHTHTHHTP 38


>sp|P04276|VTDB_RAT Vitamin D-binding protein OS=Rattus norvegicus
GN=Gc PE=1 SV=3
Length = 476

Score = 30.8 bits (68), Expect = 5.4
Identities = 19/44 (43%), Positives = 21/44 (47%)
Frame = +3

Query: 21 YSSGYSQHPCPLENTFKKDYSH*EGLACTSPNAHTTCTIARERL 152
YSS Y Q P PL + K Y G CTS A T +ERL
Sbjct: 163 YSSNYGQAPLPLLVGYTKSYLSMVGSCCTS--AKPTVCFLKERL 204


>sp|O14960|LECT2_HUMAN Leukocyte cell-derived chemotaxin-2 OS=Homo
sapiens GN=LECT2 PE=2 SV=1
Length = 151

Score = 30.4 bits (67), Expect = 7.1
Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 3/54 (5%)
Frame = -2

Query: 244 ACASPGAPVCVREKEREVSRCGRAGSGQDWCNRSLAI---VQVVCALGEVQARP 92
A A P A +C + E+ C R G GQ RS V V+C+ G P
Sbjct: 16 ALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAP 69


>sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3
OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3
SV=1
Length = 486

Score = 30.0 bits (66), Expect = 9.2
Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
Frame = +2

Query: 236 RTRSHTPAPHTLETSKEEREKGRKDDAKIDNDSFSFKP-ETMYKLHEPCSRLRHGHRRFI 412
+ SHTP+P +E +++ R ++A+ D+ SFK + L E C L G++
Sbjct: 27 KKESHTPSPEPIEDTEDNRVIEETEEAEEDDAPKSFKDLGIVDSLCEACDTL--GYK--- 81

Query: 413 QRGTHLPRQTESVDTRLDGK 472
P Q ES+ L G+
Sbjct: 82 ---APTPIQRESIPLALQGR 98


>sp|Q9P7I3|MDV1_SCHPO Mitochondrial division protein 1
OS=Schizosaccharomyces pombe GN=mdv1 PE=2 SV=1
Length = 651

Score = 30.0 bits (66), Expect = 9.2
Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Frame = +2

Query: 251 TPAPHTLETSKEEREKGRKDDAKIDNDSFSFKPETMY--KLHEPCSRLR 391
+P P T KE ++ D + +DS FKP+++ KL + C++LR
Sbjct: 131 SPLPITSSNQKEGKKNVSSIDVSMVSDSSEFKPDSLQHEKLVKKCNQLR 179


>sp|A2QVS9|MCES_ASPNC mRNA cap guanine-N7 methyltransferase
OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513)
GN=abd1 PE=3 SV=1
Length = 609

Score = 30.0 bits (66), Expect = 9.2
Identities = 26/101 (25%), Positives = 40/101 (39%), Gaps = 4/101 (3%)
Frame = +2

Query: 44 PLSSRKHLQKRLFTLG----GPRLHFAQRTHNLHNC*RAITPILPAXXXXXXXXXXXXXX 211
P+S RK L++R L P +++R + A P P+
Sbjct: 152 PISKRKRLEERHQKLRKRGQAPPSAYSRRDGDETAARAAPRPRSPSPPLPPRSPSPEVQA 211

Query: 212 XXXXGPGGRTRSHTPAPHTLETSKEEREKGRKDDAKIDNDS 334
PGG R P TL +EERE+ ++DA ++ S
Sbjct: 212 RQRKRPGGGARRGLVDPQTLRRRQEERERALEEDAMRNSQS 252


tr_hit_id B1VSX3
Definition tr|B1VSX3|B1VSX3_STRGG Putative uncharacterized protein OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
Align length 38
Score (bit) 28.5
E-value 0.49
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913728|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_F02.
(596 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B1VSX3|B1VSX3_STRGG Putative uncharacterized protein OS=Strep... 28 0.49
tr|B5WHW3|B5WHW3_9BURK Metallophosphoesterase OS=Burkholderia sp... 36 1.5
tr|Q4S509|Q4S509_TETNG Chromosome 6 SCAF14737, whole genome shot... 35 2.5
tr|A7QHU4|A7QHU4_VITVI Uricase OS=Vitis vinifera GN=GSVIVT000137... 35 3.3
tr|B0CVF4|B0CVF4_LACBS Predicted protein OS=Laccaria bicolor (st... 35 3.3
tr|A2CEB9|A2CEB9_DANRE Novel protein (Fragment) OS=Danio rerio G... 35 4.3
tr|Q3T9P7|Q3T9P7_MOUSE Putative uncharacterized protein OS=Mus m... 35 4.3
tr|Q4YFP1|Q4YFP1_PLABE Putative uncharacterized protein (Fragmen... 35 4.3
tr|A8XF46|A8XF46_CAEBR Putative uncharacterized protein OS=Caeno... 34 7.3
tr|A8QHG3|A8QHG3_BRUMA Putative uncharacterized protein OS=Brugi... 34 7.3
tr|B4L7N8|B4L7N8_DROMO GI10907 OS=Drosophila mojavensis GN=GI109... 26 9.3
tr|A6S6W3|A6S6W3_BOTFB Predicted protein OS=Botryotinia fuckelia... 33 9.5
tr|A6S093|A6S093_BOTFB Putative uncharacterized protein OS=Botry... 33 9.5

>tr|B1VSX3|B1VSX3_STRGG Putative uncharacterized protein
OS=Streptomyces griseus subsp. griseus (strain JCM 4626
/ NBRC 13350) GN=SGR_848 PE=4 SV=1
Length = 348

Score = 28.5 bits (62), Expect(2) = 0.49
Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%)
Frame = +1

Query: 388 TPWPSPLHTEGHTPPS-TNRIRRHTPRREDSPLASHRR 498
T P HT HT P+ N R H + P ++HRR
Sbjct: 295 THGPGDAHTHAHTHPACENPARGHPQPHDHGPASAHRR 332



Score = 27.7 bits (60), Expect(2) = 0.49
Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 1/19 (5%)
Frame = +3

Query: 216 HTGAPGDAHAHTHRH-HTP 269
HT PGDAH TH H H P
Sbjct: 256 HTHGPGDAHTLTHAHTHGP 274


>tr|B5WHW3|B5WHW3_9BURK Metallophosphoesterase OS=Burkholderia sp.
H160 GN=BH160DRAFT_2664 PE=4 SV=1
Length = 313

Score = 36.2 bits (82), Expect = 1.5
Identities = 17/40 (42%), Positives = 19/40 (47%)
Frame = +3

Query: 153 HQSCPLPALPHLDTSLSFSLTHTGAPGDAHAHTHRHHTPW 272
H PLPA P LD H P D+HA HR+ T W
Sbjct: 31 HHGLPLPATPSLDA-------HADHPDDSHADPHRYRTIW 63


>tr|Q4S509|Q4S509_TETNG Chromosome 6 SCAF14737, whole genome shotgun
sequence OS=Tetraodon nigroviridis GN=GSTENG00023941001
PE=4 SV=1
Length = 168

Score = 35.4 bits (80), Expect = 2.5
Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 8/64 (12%)
Frame = +3

Query: 93 GLAC--TSPNAHTTCTIARERLHQSC------PLPALPHLDTSLSFSLTHTGAPGDAHAH 248
GL C T PN C A H S P P P SLS S THT H H
Sbjct: 98 GLGCNLTCPNYARVCRYAYRSRHTSTRRCTDSPPPRSPSHSLSLSLSYTHT----HTHTH 153

Query: 249 THRH 260
TH H
Sbjct: 154 THTH 157


>tr|A7QHU4|A7QHU4_VITVI Uricase OS=Vitis vinifera
GN=GSVIVT00013798001 PE=3 SV=1
Length = 295

Score = 35.0 bits (79), Expect = 3.3
Identities = 24/59 (40%), Positives = 27/59 (45%), Gaps = 8/59 (13%)
Frame = +3

Query: 108 SPNAHTTC-----TIARERLHQSCPLPALPHLDT---SLSFSLTHTGAPGDAHAHTHRH 260
SP+ +T T+ L S PLP P L SLS SLTHT H HTH H
Sbjct: 234 SPSVQSTLYQMAKTVLNRSLSLSLPLPPSPSLSPFSLSLSLSLTHT----HTHTHTHMH 288


>tr|B0CVF4|B0CVF4_LACBS Predicted protein OS=Laccaria bicolor
(strain S238N-H82) GN=LACBIDRAFT_322879 PE=4 SV=1
Length = 656

Score = 35.0 bits (79), Expect = 3.3
Identities = 25/93 (26%), Positives = 32/93 (34%)
Frame = +3

Query: 105 TSPNAHTTCTIARERLHQSCPLPALPHLDTSLSFSLTHTGAPGDAHAHTHRHHTPWXXXX 284
T+P H T R R H + L A L T + D HAH RH +P
Sbjct: 13 TTPQRHVTSLSKRARQHVATSLSATCLLTPGTRRGTTTSTHDHDHHAHRRRHASPRQRRA 72

Query: 285 XXXXXXXXTTPKSTMTASLSNQKPCTNSMNRAQ 383
TTP A+ ++ N R Q
Sbjct: 73 TPTNDTPTTTPPPRQRATTASTDAHVNGRRRRQ 105


>tr|A2CEB9|A2CEB9_DANRE Novel protein (Fragment) OS=Danio rerio
GN=CH211-169K21.2-001 PE=4 SV=1
Length = 518

Score = 34.7 bits (78), Expect = 4.3
Identities = 19/49 (38%), Positives = 26/49 (53%)
Frame = +1

Query: 1 HTHNCPYIAQGIHSTPVLSKTPSKKTIHTRRASPALRPTHTQPAQLLES 147
H+H C A +HS+PV S PS H ++PA + THT L+S
Sbjct: 118 HSHGCSSPALSLHSSPVSSPCPSPIQQHYTSSTPA-QKTHTDLQSRLQS 165


>tr|Q3T9P7|Q3T9P7_MOUSE Putative uncharacterized protein OS=Mus
musculus PE=4 SV=1
Length = 101

Score = 34.7 bits (78), Expect = 4.3
Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
Frame = +3

Query: 111 PNAHTTCTIAR-ERLHQSCPLPALPHLDTSLSFSLTHTGAPGDAHAHTHRH 260
PN ++T + + E +H S L L SLS SL+HT H HTH H
Sbjct: 51 PNMYSTLGLTQSEHMHTSLSLSL--SLSLSLSLSLSHTHTHTHTHTHTHTH 99


>tr|Q4YFP1|Q4YFP1_PLABE Putative uncharacterized protein (Fragment)
OS=Plasmodium berghei GN=PB404290.00.0 PE=4 SV=1
Length = 149

Score = 34.7 bits (78), Expect = 4.3
Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 4/92 (4%)
Frame = +3

Query: 3 HTQLPLYSSGYSQ-HPCPLENTFKKDYSH*EGLACTSPNAHT-TCTIARERLHQSCPLPA 176
HT +YS ++ H +T + +SH T + HT T T H +
Sbjct: 31 HTHSHIYSHTHTHTHSHTHTHTHTQTHSHIYSHTHTHIHTHTHTLTYTHSHTHSHTHIHT 90

Query: 177 LPH-LDTSLSFSLTHTGAPGDAHAHTHRH-HT 266
L + L +L+++LTH H HTH H HT
Sbjct: 91 LTYTLTHTLTYTLTHIFTHTHTHTHTHTHTHT 122


>tr|A8XF46|A8XF46_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG12265 PE=4 SV=2
Length = 1901

Score = 33.9 bits (76), Expect = 7.3
Identities = 18/45 (40%), Positives = 21/45 (46%)
Frame = +3

Query: 135 IARERLHQSCPLPALPHLDTSLSFSLTHTGAPGDAHAHTHRHHTP 269
I RE +H P PA T +S + T T P H H H HH P
Sbjct: 1065 IVRETVH---PTPARAASPTQISVTFTATAHPIHHHHHHHHHHPP 1106


>tr|A8QHG3|A8QHG3_BRUMA Putative uncharacterized protein OS=Brugia
malayi GN=Bm1_56950 PE=4 SV=1
Length = 214

Score = 33.9 bits (76), Expect = 7.3
Identities = 18/54 (33%), Positives = 23/54 (42%)
Frame = +2

Query: 242 RSHTPAPHTLETSKEEREKGRKDDAKIDNDSFSFKPETMYKLHEPCSRLRHGHR 403
RSHTP H + R R + D+D ++ P T K E CS G R
Sbjct: 93 RSHTPTYHERSPTPISRNNKRPNSDLSDDDDYAIGPTTRRKWQEYCSTKTKGQR 146