BP913735
Clone id YMU001_000033_F09
Library
Length 169
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000033_F09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACTATTTTGTACATAGCCAAGCACCCTGTGGGAGTGGATGAAAAGCTACAGTTGGCGTTG
GATCTGATGCAAATCGATAAGGCGCAGAAGGGGTTTCACAAATTGGGTATCTATGGCATG
GGAGGAGTGGGGAAGACCACTTTGGCCAAATCCATTTACAATGCCATTT
■■Homology search results ■■ -
sp_hit_id Q40392
Definition sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa
Align length 47
Score (bit) 41.6
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913735|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_F09.
(169 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glut... 42 0.001
sp|Q9FG90|DRL33_ARATH Probable disease resistance protein At5g43... 39 0.006
sp|Q9M667|RPP13_ARATH Disease resistance protein RPP13 OS=Arabid... 39 0.008
sp|Q9STE7|R13L3_ARATH Putative disease resistance RPP13-like pro... 39 0.008
sp|O64789|DRL18_ARATH Putative disease resistance protein At1g61... 38 0.014
sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27... 38 0.018
sp|O22727|DRL16_ARATH Putative disease resistance protein At1g61... 38 0.018
sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43... 37 0.023
sp|Q9SH22|DRL20_ARATH Putative disease resistance protein At1g63... 37 0.023
sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=A... 37 0.031
sp|Q9LMP6|DRL3_ARATH Probable disease resistance protein At1g158... 37 0.031
sp|O64790|DRL17_ARATH Probable disease resistance protein At1g61... 37 0.031
sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61... 37 0.031
sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Ar... 37 0.040
sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10... 37 0.040
sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47... 36 0.052
sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05... 36 0.068
sp|P60839|DRL2_ARATH Probable disease resistance protein At1g122... 35 0.089
sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62... 35 0.089
sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=A... 35 0.12
sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidop... 35 0.12
sp|O23317|DRL24_ARATH Probable disease resistance protein At4g14... 35 0.12
sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=... 35 0.15
sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidop... 34 0.20
sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like prot... 34 0.20
sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidop... 34 0.20
sp|Q9STE5|R13L2_ARATH Putative disease resistance RPP13-like pro... 34 0.20
sp|O04093|RP8L1_ARATH Putative disease resistance protein RPP8-l... 34 0.26
sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63... 34 0.26
sp|Q9LQ54|DRL12_ARATH Probable disease resistance protein At1g59... 34 0.26

>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana
glutinosa GN=N PE=1 SV=1
Length = 1144

Score = 41.6 bits (96), Expect = 0.001
Identities = 20/47 (42%), Positives = 32/47 (68%)
Frame = +1

Query: 28 VGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
VG+D L+ L++I G +GI+GMGGVGKTT+A++I++ +
Sbjct: 189 VGIDTHLEKIESLLEI--GINGVRIMGIWGMGGVGKTTIARAIFDTL 233


>sp|Q9FG90|DRL33_ARATH Probable disease resistance protein At5g43740
OS=Arabidopsis thaliana GN=At5g43740 PE=2 SV=1
Length = 862

Score = 39.3 bits (90), Expect = 0.006
Identities = 20/45 (44%), Positives = 30/45 (66%)
Frame = +1

Query: 28 VGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
VG+D+ +++A + D+ LG+YGMGGVGKTTL +S+ N
Sbjct: 153 VGLDKLVEMAWSSLMNDE----IGTLGLYGMGGVGKTTLLESLNN 193


>sp|Q9M667|RPP13_ARATH Disease resistance protein RPP13
OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2
Length = 835

Score = 38.9 bits (89), Expect = 0.008
Identities = 17/46 (36%), Positives = 32/46 (69%)
Frame = +1

Query: 28 VGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNA 165
VG+++ ++ L+ + +D +K + I+GMGG+GKT LA+ +YN+
Sbjct: 164 VGLEDDAKILLEKL-LDYEEKNRFIISIFGMGGLGKTALARKLYNS 208


>sp|Q9STE7|R13L3_ARATH Putative disease resistance RPP13-like
protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=2 SV=1
Length = 847

Score = 38.9 bits (89), Expect = 0.008
Identities = 16/46 (34%), Positives = 31/46 (67%)
Frame = +1

Query: 28 VGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNA 165
VG+++ +++ L + D + + + I+GMGG+GKT LA+ +YN+
Sbjct: 163 VGLEDDVKILLVKLLSDNEKDKSYIISIFGMGGLGKTALARKLYNS 208


>sp|O64789|DRL18_ARATH Putative disease resistance protein At1g61310
OS=Arabidopsis thaliana GN=At1g61310 PE=3 SV=1
Length = 925

Score = 38.1 bits (87), Expect = 0.014
Identities = 20/45 (44%), Positives = 29/45 (64%)
Frame = +1

Query: 28 VGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
+G +E L+ A + + D G +G++GMGGVGKTTL K I+N
Sbjct: 156 IGQEEMLEKAWNRLMED----GVGIMGLHGMGGVGKTTLFKKIHN 196


>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220
OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1
Length = 919

Score = 37.7 bits (86), Expect = 0.018
Identities = 16/35 (45%), Positives = 25/35 (71%)
Frame = +1

Query: 58 LDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
LD ++ +K K+G++GMGGVGKTTL +++ N
Sbjct: 122 LDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNN 156


>sp|O22727|DRL16_ARATH Putative disease resistance protein At1g61190
OS=Arabidopsis thaliana GN=At1g61190 PE=5 SV=1
Length = 967

Score = 37.7 bits (86), Expect = 0.018
Identities = 20/45 (44%), Positives = 29/45 (64%)
Frame = +1

Query: 28 VGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
+G +E L+ A + + D G +G++GMGGVGKTTL K I+N
Sbjct: 155 IGQEEMLKKAWNRLMED----GVGIMGLHGMGGVGKTTLFKKIHN 195


>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730
OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1
Length = 848

Score = 37.4 bits (85), Expect = 0.023
Identities = 19/45 (42%), Positives = 30/45 (66%)
Frame = +1

Query: 28 VGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
VG+D + +A + + D+ + LG+YGMGG+GKTTL +S+ N
Sbjct: 154 VGLDTMVGIAWESLIDDEIRT----LGLYGMGGIGKTTLLESLNN 194


>sp|Q9SH22|DRL20_ARATH Putative disease resistance protein At1g63360
OS=Arabidopsis thaliana GN=At1g63360 PE=3 SV=1
Length = 884

Score = 37.4 bits (85), Expect = 0.023
Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 5/35 (14%)
Frame = +1

Query: 73 IDKAQK-----GFHKLGIYGMGGVGKTTLAKSIYN 162
+DKA K G +G+YGMGGVGKTTL +YN
Sbjct: 160 LDKAGKHLMEDGVGIMGMYGMGGVGKTTLLTQLYN 194


>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52
OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3
Length = 1288

Score = 37.0 bits (84), Expect = 0.031
Identities = 21/54 (38%), Positives = 36/54 (66%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
T Y+ + +G+ KL L ++ M ++K G +GI+GM G+GKTTLAK++++
Sbjct: 145 THFYVGR--IGIYSKL-LEIENM-VNKQPIGIRCVGIWGMPGIGKTTLAKAVFD 194


tr_hit_id A2Q6G3
Definition tr|A2Q6G3|A2Q6G3_MEDTR TIR; AAA ATPase OS=Medicago truncatula
Align length 56
Score (bit) 57.0
E-value 5.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913735|Adiantum capillus-veneris mRNA, clone:
YMU001_000033_F09.
(169 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2Q6G3|A2Q6G3_MEDTR TIR; AAA ATPase OS=Medicago truncatula GN... 57 5e-07
tr|B3VNQ1|B3VNQ1_TOBAC NBS-coding resistance gene protein (Fragm... 55 1e-06
tr|B3VNQ0|B3VNQ0_TOBAC NBS-coding resistance gene protein (Fragm... 55 1e-06
tr|A2Q6G7|A2Q6G7_MEDTR TIR; Disease resistance protein OS=Medica... 54 4e-06
tr|A2Q6G2|A2Q6G2_MEDTR TIR; Disease resistance protein OS=Medica... 54 4e-06
tr|B3VTL6|B3VTL6_MEDTR TIR-NBS-LRR RCT1 resistance protein OS=Me... 53 7e-06
tr|B3VNQ2|B3VNQ2_TOBAC NBS-coding resistance gene protein (Fragm... 53 7e-06
tr|Q8W2C0|Q8W2C0_SOYBN Functional candidate resistance protein K... 53 9e-06
tr|B3VTL7|B3VTL7_MEDSA TIR-NBS-LRR RCT1-like resistance protein ... 53 9e-06
tr|B3VNQ7|B3VNQ7_TOBAC NBS-coding resistance gene protein (Fragm... 52 1e-05
tr|B3VNQ5|B3VNQ5_TOBAC NBS-coding resistance gene protein (Fragm... 52 1e-05
tr|B3VNQ4|B3VNQ4_TOBAC NBS-coding resistance gene protein (Fragm... 52 1e-05
tr|B3V7Z2|B3V7Z2_NICSY NBS-coding resistance gene analog (Fragme... 52 1e-05
tr|B3V7Z1|B3V7Z1_NICGU NBS-coding resistance gene analog (Fragme... 52 2e-05
tr|B3V7Z0|B3V7Z0_9SOLA NBS-coding resistance gene analog (Fragme... 52 2e-05
tr|B3V7Y6|B3V7Y6_TOBAC NBS-coding resistance gene analog (Fragme... 52 2e-05
tr|B3V7Y4|B3V7Y4_TOBAC NBS-coding resistance gene analog (Fragme... 52 2e-05
tr|B3V7Y3|B3V7Y3_TOBAC NBS-coding resistance gene analog (Fragme... 52 2e-05
tr|B3V7Y2|B3V7Y2_TOBAC NBS-coding resistance gene analog (Fragme... 52 2e-05
tr|Q9FVK3|Q9FVK3_SOYBN Resistance protein MG63 (Fragment) OS=Gly... 51 2e-05
tr|B3VNR1|B3VNR1_TOBAC NBS-coding resistance gene protein (Fragm... 51 2e-05
tr|B3VNR0|B3VNR0_TOBAC NBS-coding resistance gene protein (Fragm... 51 2e-05
tr|B3VNQ6|B3VNQ6_TOBAC NBS-coding resistance gene protein (Fragm... 51 2e-05
tr|B3VNQ3|B3VNQ3_TOBAC NBS-coding resistance gene protein (Fragm... 51 2e-05
tr|B3VNP8|B3VNP8_TOBAC NBS-coding resistance gene protein (Fragm... 51 2e-05
tr|P93244|P93244_LINUS Rust resistance protein M OS=Linum usitat... 51 3e-05
tr|B3VNQ8|B3VNQ8_TOBAC NBS-coding resistance gene protein (Fragm... 51 3e-05
tr|B8LMX8|B8LMX8_PICSI Putative uncharacterized protein OS=Picea... 50 4e-05
tr|B3VNQ9|B3VNQ9_TOBAC NBS-coding resistance gene protein (Fragm... 50 4e-05
tr|A7QH66|A7QH66_VITVI Chromosome chr18 scaffold_96, whole genom... 50 4e-05

>tr|A2Q6G3|A2Q6G3_MEDTR TIR; AAA ATPase OS=Medicago truncatula
GN=MtrDRAFT_AC183371g7v1 PE=4 SV=1
Length = 1474

Score = 57.0 bits (136), Expect = 5e-07
Identities = 28/56 (50%), Positives = 40/56 (71%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
T L++A HPVGVD ++Q + L+ ++ K LGI+GMGG+GKTT+AK+ YN I
Sbjct: 561 TDLFVADHPVGVDSRVQDVIQLLN-NQESKDPLLLGIWGMGGIGKTTIAKAAYNKI 615



Score = 54.3 bits (129), Expect = 3e-06
Identities = 26/56 (46%), Positives = 37/56 (66%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
T ++ HPVGVD ++Q + L+ + K LGI+GMGG+GKTT+AK+ YN I
Sbjct: 59 TDFFVVDHPVGVDSRVQDVIQLLN-GQESKDPRLLGIWGMGGIGKTTIAKAAYNKI 113


>tr|B3VNQ1|B3VNQ1_TOBAC NBS-coding resistance gene protein
(Fragment) OS=Nicotiana tabacum GN=NBS182_N12 PE=4 SV=1
Length = 288

Score = 55.5 bits (132), Expect = 1e-06
Identities = 26/54 (48%), Positives = 41/54 (75%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
T L +A HPVGVD +++ ++L+ ++ + G +GI+G+GG+GKTTLAK+IYN
Sbjct: 24 TPLDVAWHPVGVDSRVK-DIELLLQNECEDGVRMIGIHGVGGIGKTTLAKAIYN 76


>tr|B3VNQ0|B3VNQ0_TOBAC NBS-coding resistance gene protein
(Fragment) OS=Nicotiana tabacum GN=NBS182_N11 PE=4 SV=1
Length = 288

Score = 55.5 bits (132), Expect = 1e-06
Identities = 26/54 (48%), Positives = 41/54 (75%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
T L +A HPVGVD +++ ++L+ ++ + G +GI+G+GG+GKTTLAK+IYN
Sbjct: 24 TPLDVAWHPVGVDSRVK-DIELLLQNECEDGVRMIGIHGVGGIGKTTLAKAIYN 76


>tr|A2Q6G7|A2Q6G7_MEDTR TIR; Disease resistance protein OS=Medicago
truncatula GN=MtrDRAFT_AC183371g1v1 PE=4 SV=1
Length = 349

Score = 53.9 bits (128), Expect = 4e-06
Identities = 25/56 (44%), Positives = 41/56 (73%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
T L++A HPVGV+ ++Q + L++ +++ LGI+G GG+GKTT+AK++YN I
Sbjct: 10 TNLFVADHPVGVESRVQEVIQLLKSRQSEDPV-LLGIWGGGGIGKTTIAKAVYNEI 64


>tr|A2Q6G2|A2Q6G2_MEDTR TIR; Disease resistance protein OS=Medicago
truncatula GN=MtrDRAFT_AC183371g3v1 PE=4 SV=1
Length = 495

Score = 53.9 bits (128), Expect = 4e-06
Identities = 25/56 (44%), Positives = 39/56 (69%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
T L++A HPVGV ++Q + L+ +++ LG++GMGG+GKTT+AK+ YN I
Sbjct: 14 TDLFVADHPVGVKSRVQDIIQLLNSQESKSPL-LLGVWGMGGIGKTTIAKAAYNKI 68


>tr|B3VTL6|B3VTL6_MEDTR TIR-NBS-LRR RCT1 resistance protein
OS=Medicago truncatula GN=RCT1 PE=2 SV=1
Length = 1098

Score = 53.1 bits (126), Expect = 7e-06
Identities = 25/56 (44%), Positives = 39/56 (69%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
T L++A +PVG+D ++Q + L+ + LG++GMGG+GKTT+AK+IYN I
Sbjct: 206 TDLFVADNPVGIDSRVQDMIQLLDTQQTNDVL-LLGMWGMGGIGKTTVAKAIYNKI 260


>tr|B3VNQ2|B3VNQ2_TOBAC NBS-coding resistance gene protein
(Fragment) OS=Nicotiana tabacum GN=NBS182_N13 PE=4 SV=1
Length = 289

Score = 53.1 bits (126), Expect = 7e-06
Identities = 27/56 (48%), Positives = 40/56 (71%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
T L +A HPVGVD +++ L+QI+ + +GI+G+GG+GKTTLAK+IYN +
Sbjct: 25 TPLDVAWHPVGVDSRVKDIELLLQIE-CEDEVRMIGIHGVGGIGKTTLAKAIYNRV 79


>tr|Q8W2C0|Q8W2C0_SOYBN Functional candidate resistance protein KR1
OS=Glycine max GN=KR1 PE=2 SV=1
Length = 1124

Score = 52.8 bits (125), Expect = 9e-06
Identities = 24/54 (44%), Positives = 39/54 (72%)
Frame = +1

Query: 7 LYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
L++A +PVG++ ++Q L+ + + H LGI+G+GGVGKTTLA ++YN+I
Sbjct: 190 LHVADYPVGLESRIQEVKALLDVG-SDDVVHMLGIHGLGGVGKTTLAAAVYNSI 242


>tr|B3VTL7|B3VTL7_MEDSA TIR-NBS-LRR RCT1-like resistance protein
OS=Medicago sativa PE=2 SV=1
Length = 1125

Score = 52.8 bits (125), Expect = 9e-06
Identities = 25/56 (44%), Positives = 39/56 (69%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYNAI 168
T L++A +PVGV+ ++Q + L+ + LG++GMGG+GKTT+AK+IYN I
Sbjct: 231 TDLFVANNPVGVESRVQDMIQLLDTQQTNDVL-LLGMWGMGGIGKTTIAKAIYNKI 285


>tr|B3VNQ7|B3VNQ7_TOBAC NBS-coding resistance gene protein
(Fragment) OS=Nicotiana tabacum GN=NBS182_N4 PE=4 SV=1
Length = 258

Score = 52.4 bits (124), Expect = 1e-05
Identities = 25/54 (46%), Positives = 40/54 (74%)
Frame = +1

Query: 1 TILYIAKHPVGVDEKLQLALDLMQIDKAQKGFHKLGIYGMGGVGKTTLAKSIYN 162
T L +A HPVG D +++ ++L+ ++ + G +GI+G+GG+GKTTLAK+IYN
Sbjct: 16 TPLDVAWHPVGEDYRVK-DIELLLQNECEDGVRMIGIHGVGGIGKTTLAKAIYN 68