BP913776
Clone id YMU001_000035_B06
Library
Length 318
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000035_B06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATAAGATCGTTTGAAGACAAGCTAGATGTAAATGTGACATCGCTGTCACAAACATACTCA
GTAACCACCGTACTGATCTCACTAGCATCTGTCATGCCAAAATCTGTATCACGCATCTGT
CGTCTCCGTTGTCTCAAACGCCTGAAACATCGACGCCTAATGTGCCCTCTATGTCCACAA
TGCCAACATGTCAAGTCTCTATGCCGTCGAGACTTGCGTGTGGGACCAATCTCTCCCATG
GACATAGAAGTGGGACTAGACTCCCCTGTAGACATGGATGTCGCGTACATAGCATGTAAA
CTCTGCCATAAAGCATGA
■■Homology search results ■■ -
sp_hit_id O84375
Definition sp|O84375|ARODE_CHLTR Shikimate biosynthesis protein aroDE OS=Chlamydia trachomatis
Align length 94
Score (bit) 32.3
E-value 0.75
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913776|Adiantum capillus-veneris mRNA, clone:
YMU001_000035_B06.
(318 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O84375|ARODE_CHLTR Shikimate biosynthesis protein aroDE OS=Ch... 32 0.75
sp|Q3MBU3|PPNK1_ANAVT Probable inorganic polyphosphate/ATP-NAD k... 31 1.7
sp|Q5N133|PPNK1_SYNP6 Probable inorganic polyphosphate/ATP-NAD k... 31 2.2
sp|Q46JK2|PPNK1_PROMT Probable inorganic polyphosphate/ATP-NAD k... 29 6.3
sp|Q7V8H9|PPNK1_PROMM Probable inorganic polyphosphate/ATP-NAD k... 29 6.3
sp|Q91ZY8|TRIM9_RAT Tripartite motif-containing protein 9 OS=Rat... 29 8.2
sp|Q8C7M3|TRIM9_MOUSE Tripartite motif-containing protein 9 OS=M... 29 8.2
sp|Q9C026|TRIM9_HUMAN Tripartite motif-containing protein 9 OS=H... 29 8.2
sp|Q29RQ5|TRIM9_BOVIN Tripartite motif-containing protein 9 OS=B... 29 8.2
sp|P37370|VRP1_YEAST Verprolin OS=Saccharomyces cerevisiae GN=VR... 29 8.3
sp|Q8YN19|PPNK1_ANASP Probable inorganic polyphosphate/ATP-NAD k... 29 8.3
sp|P98088|MUC5A_HUMAN Mucin-5AC (Fragments) OS=Homo sapiens GN=M... 29 8.3
sp|Q5T6C5|AT7L2_HUMAN Ataxin-7-like protein 2 OS=Homo sapiens GN... 29 8.3

>sp|O84375|ARODE_CHLTR Shikimate biosynthesis protein aroDE
OS=Chlamydia trachomatis GN=aroE PE=3 SV=1
Length = 478

Score = 32.3 bits (72), Expect = 0.75
Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 12/94 (12%)
Frame = +3

Query: 15 RQARCKCDIAVTNILSNHRTDLTSICHAKI------------CITHLSSPLSQTPETSTP 158
R +R C++ + N H DL S C AK I + P P+ P
Sbjct: 348 RLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELPLHRVSLIINCLPPSCTIPKAVAP 407

Query: 159 NVPSMSTMPTCQVSMPSRLACGTNLSHGHRSGTR 260
V ++T+P + G+++ +GH T+
Sbjct: 408 CVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQ 441


>sp|Q3MBU3|PPNK1_ANAVT Probable inorganic polyphosphate/ATP-NAD
kinase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC
7937) GN=ppnK1 PE=3 SV=2
Length = 305

Score = 31.2 bits (69), Expect = 1.7
Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 19/68 (27%)
Frame = +3

Query: 66 HRTDLTSICHAKICITH------------LSSPLSQTPETS-------TPNVPSMSTMPT 188
HR LTS+CH +I + +S+P T + TP VP++ +P
Sbjct: 157 HREPLTSMCHFEIAVGRHAPVDIAADGVIVSTPTGSTAYSLSAGGPVVTPGVPALQLVPI 216

Query: 189 CQVSMPSR 212
C S+ SR
Sbjct: 217 CPHSLASR 224


>sp|Q5N133|PPNK1_SYNP6 Probable inorganic polyphosphate/ATP-NAD
kinase 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC
6301 / SAUG 1402/1) GN=ppnK1 PE=3 SV=1
Length = 305

Score = 30.8 bits (68), Expect = 2.2
Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 19/73 (26%)
Frame = +3

Query: 51 NILSNHRTDLTSICHAKICI------------THLSSP-------LSQTPETSTPNVPSM 173
N ++ HR LTS+CH ++ I +S+P LS TP+VP
Sbjct: 152 NEMALHREPLTSMCHFEVAIGKHVPVDIAADGVIVSTPTGSTAYSLSSGGPVVTPDVPVF 211

Query: 174 STMPTCQVSMPSR 212
+P C S+ SR
Sbjct: 212 QLVPICPHSLASR 224


>sp|Q46JK2|PPNK1_PROMT Probable inorganic polyphosphate/ATP-NAD
kinase 1 OS=Prochlorococcus marinus (strain NATL2A)
GN=ppnK1 PE=3 SV=1
Length = 302

Score = 29.3 bits (64), Expect = 6.3
Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 19/91 (20%)
Frame = +3

Query: 15 RQARCKCDIAVTNILSNHRTDLTSICHAKICITH------------LSSP-------LSQ 137
R +C+ + N ++ HR +TS+CH +I + LS+P LS
Sbjct: 140 RGDQCRWEALCLNEMALHREPMTSMCHFEISVGRHAPVDISADGVILSTPTGSTAYSLSA 199

Query: 138 TPETSTPNVPSMSTMPTCQVSMPSRLACGTN 230
TP+ P + P S+ SR +N
Sbjct: 200 GGPVITPDCPVLQLTPVSPHSLASRALVFSN 230


>sp|Q7V8H9|PPNK1_PROMM Probable inorganic polyphosphate/ATP-NAD
kinase 1 OS=Prochlorococcus marinus (strain MIT 9313)
GN=ppnK1 PE=3 SV=1
Length = 302

Score = 29.3 bits (64), Expect = 6.3
Identities = 23/85 (27%), Positives = 34/85 (40%), Gaps = 19/85 (22%)
Frame = +3

Query: 15 RQARCKCDIAVTNILSNHRTDLTSICHAKICITH------------LSSP-------LSQ 137
R +C+ + N ++ HR LTS+CH ++ I LS+P LS
Sbjct: 140 RGDQCRWEALSLNEMALHREPLTSMCHFEVAIGRHAPVDISADGVILSTPTGSTAYALSA 199

Query: 138 TPETSTPNVPSMSTMPTCQVSMPSR 212
TP P + P S+ SR
Sbjct: 200 GGPVITPECPVLQLAPIAPHSLASR 224


>sp|Q91ZY8|TRIM9_RAT Tripartite motif-containing protein 9 OS=Rattus
norvegicus GN=Trim9 PE=1 SV=1
Length = 710

Score = 28.9 bits (63), Expect = 8.2
Identities = 18/51 (35%), Positives = 24/51 (47%)
Frame = +1

Query: 163 CPLCPQCQHVKSLCRRDLRVGPISPMDIEVGLDSPVDMDVAYIACKLCHKA 315
C CPQC L R LR P + + +E +D A + C+LC KA
Sbjct: 125 CITCPQCHRSLILDDRGLRGFPKNRV-LEGVIDRYQQSKAAALKCQLCEKA 174


>sp|Q8C7M3|TRIM9_MOUSE Tripartite motif-containing protein 9 OS=Mus
musculus GN=Trim9 PE=2 SV=2
Length = 817

Score = 28.9 bits (63), Expect = 8.2
Identities = 18/51 (35%), Positives = 24/51 (47%)
Frame = +1

Query: 163 CPLCPQCQHVKSLCRRDLRVGPISPMDIEVGLDSPVDMDVAYIACKLCHKA 315
C CPQC L R LR P + + +E +D A + C+LC KA
Sbjct: 125 CITCPQCHRSLILDDRGLRGFPKNRV-LEGVIDRYQQSKAAALKCQLCEKA 174


>sp|Q9C026|TRIM9_HUMAN Tripartite motif-containing protein 9 OS=Homo
sapiens GN=TRIM9 PE=1 SV=1
Length = 710

Score = 28.9 bits (63), Expect = 8.2
Identities = 18/51 (35%), Positives = 24/51 (47%)
Frame = +1

Query: 163 CPLCPQCQHVKSLCRRDLRVGPISPMDIEVGLDSPVDMDVAYIACKLCHKA 315
C CPQC L R LR P + + +E +D A + C+LC KA
Sbjct: 125 CITCPQCHRSLILDDRGLRGFPKNRV-LEGVIDRYQQSKAAALKCQLCEKA 174


>sp|Q29RQ5|TRIM9_BOVIN Tripartite motif-containing protein 9 OS=Bos
taurus GN=TRIM9 PE=2 SV=1
Length = 710

Score = 28.9 bits (63), Expect = 8.2
Identities = 18/51 (35%), Positives = 24/51 (47%)
Frame = +1

Query: 163 CPLCPQCQHVKSLCRRDLRVGPISPMDIEVGLDSPVDMDVAYIACKLCHKA 315
C CPQC L R LR P + + +E +D A + C+LC KA
Sbjct: 125 CITCPQCHRSLILDDRGLRGFPKNRV-LEGVIDRYQQSKAAALKCQLCEKA 174


>sp|P37370|VRP1_YEAST Verprolin OS=Saccharomyces cerevisiae GN=VRP1
PE=1 SV=2
Length = 817

Score = 28.9 bits (63), Expect = 8.3
Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 7/53 (13%)
Frame = +3

Query: 129 LSQTPETSTPNVPSMSTMPTCQVSMPSR-------LACGTNLSHGHRSGTRLP 266
+S+ P S P PS STM T + PS+ G+ L H H + T P
Sbjct: 696 ISKNPTKSPPPPPSPSTMDTGTSNSPSKNLKQRLFSTGGSTLQHKHNTHTNQP 748


tr_hit_id A7Q1F1
Definition tr|A7Q1F1|A7Q1F1_VITVI Chromosome chr7 scaffold_44, whole genome shotgun sequence OS=Vitis vinifera
Align length 50
Score (bit) 36.2
E-value 0.84
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913776|Adiantum capillus-veneris mRNA, clone:
YMU001_000035_B06.
(318 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q1F1|A7Q1F1_VITVI Chromosome chr7 scaffold_44, whole genome... 36 0.84
tr|A6SLQ9|A6SLQ9_BOTFB Putative uncharacterized protein OS=Botry... 36 1.1
tr|B0U6F0|B0U6F0_XYLFM Putative uncharacterized protein OS=Xylel... 35 1.4
tr|A7EUW3|A7EUW3_SCLS1 Putative uncharacterized protein OS=Scler... 34 3.2
tr|A8LV97|A8LV97_SALAI Putative uncharacterized protein OS=Salin... 33 9.3

>tr|A7Q1F1|A7Q1F1_VITVI Chromosome chr7 scaffold_44, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028438001
PE=4 SV=1
Length = 1428

Score = 36.2 bits (82), Expect = 0.84
Identities = 18/50 (36%), Positives = 26/50 (52%)
Frame = +3

Query: 93 HAKICITHLSSPLSQTPETSTPNVPSMSTMPTCQVSMPSRLACGTNLSHG 242
HA + SS +S TP+TS P++P T + S L GT++S G
Sbjct: 499 HASPSLREKSSQISFTPQTSAPHLPGYGTSAIVAMDRSSSLPSGTSISSG 548


>tr|A6SLQ9|A6SLQ9_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_13492
PE=4 SV=1
Length = 283

Score = 35.8 bits (81), Expect = 1.1
Identities = 18/61 (29%), Positives = 31/61 (50%)
Frame = +3

Query: 63 NHRTDLTSICHAKICITHLSSPLSQTPETSTPNVPSMSTMPTCQVSMPSRLACGTNLSHG 242
N RTD+TS C + + +PL++ P + S+S +C P++L +L HG
Sbjct: 178 NTRTDITSFCQSNGIVVEAYAPLARALRMKHPKIVSLSKKYSCS---PAQLLVKWSLQHG 234

Query: 243 H 245
+
Sbjct: 235 Y 235


>tr|B0U6F0|B0U6F0_XYLFM Putative uncharacterized protein OS=Xylella
fastidiosa (strain M12) GN=Xfasm12_2277 PE=4 SV=1
Length = 157

Score = 35.4 bits (80), Expect = 1.4
Identities = 21/70 (30%), Positives = 30/70 (42%)
Frame = +3

Query: 66 HRTDLTSICHAKICITHLSSPLSQTPETSTPNVPSMSTMPTCQVSMPSRLACGTNLSHGH 245
HR +T IC+ + SP Q S P VP + +PT + S L T +H
Sbjct: 17 HRVSMTRATPPWICVDN--SPCPQCTHESAPAVPMQTPIPTRKASTLMTLTALTQRAHRQ 74

Query: 246 RSGTRLPCRH 275
R + +P H
Sbjct: 75 RIASAIPMLH 84


>tr|A7EUW3|A7EUW3_SCLS1 Putative uncharacterized protein
OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 /
Ss-1) GN=SS1G_09121 PE=4 SV=1
Length = 283

Score = 34.3 bits (77), Expect = 3.2
Identities = 18/61 (29%), Positives = 31/61 (50%)
Frame = +3

Query: 63 NHRTDLTSICHAKICITHLSSPLSQTPETSTPNVPSMSTMPTCQVSMPSRLACGTNLSHG 242
N RT++TS C + + +PL Q + P + S+S +C P++L +L HG
Sbjct: 178 NTRTNITSFCQSNGIVVEAYAPLVQALRMTHPKIVSLSRKYSC---TPAQLLVRWSLQHG 234

Query: 243 H 245
+
Sbjct: 235 Y 235


>tr|A8LV97|A8LV97_SALAI Putative uncharacterized protein
OS=Salinispora arenicola (strain CNS-205) GN=Sare_4835
PE=4 SV=1
Length = 1168

Score = 32.7 bits (73), Expect = 9.3
Identities = 18/60 (30%), Positives = 31/60 (51%)
Frame = +3

Query: 36 DIAVTNILSNHRTDLTSICHAKICITHLSSPLSQTPETSTPNVPSMSTMPTCQVSMPSRL 215
D++V I S + I ++ + +S+P TP+ STP+V +P+ +VS P L
Sbjct: 240 DLSVPEI-STPEVSMPEISTPEVSMPEISTPDVSTPDLSTPDVSPPGEIPSPEVSSPGEL 298