BP913828
Clone id YMU001_000035_G10
Library
Length 397
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000035_G10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TAGTGCCACACCGCAATGTCAACTTCTGTAGTTGCTCCACAAGCTGAAGGTTGTGTGCTA
ACAGTACACAAGTAAAGTGTACCGACTTTTTCACCCTTGGCAACCACCAAAGATCCCTTT
GAGATCTTCCACCGTTTGTTTCCGAATGCAATGTTGTGACCTTCATCGTCCAATTGTCCT
GTAAAGATCAAATTTTTGCGAAGAGAAGGAACATGCCTAACATCTTTAAGCTTCCATTCA
TTTCCGTTAGCAGTTTTGACAGAAACTGTACCTTTGCCGACAATCTCACAAGCTTCATCA
TCTCCCAAGTATACATACCCAAAATTACTCTTGTTGTAGTCTTGGAAATGTATCTTGTGT
GGTGTCGCACGAAATGAAGCCCCGGAATCTACTATCC
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 132
Score (bit) 99.0
E-value 7.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913828|Adiantum capillus-veneris mRNA, clone:
YMU001_000035_G10.
(397 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 99 7e-21
sp|P25601|YCH5_YEAST Putative transposon Ty5-1 protein YCL075W O... 30 2.9
sp|Q6JAN0|GPR98_DANRE G-protein coupled receptor 98 OS=Danio rer... 30 2.9
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sap... 30 3.7
sp|O43078|SUR2_SCHPO Protein sur2 OS=Schizosaccharomyces pombe G... 30 4.9
sp|Q708S7|ACC2B_DANRE Amiloride-sensitive cation channel 2-B, ne... 29 6.4
sp|P16662|UD2B7_HUMAN UDP-glucuronosyltransferase 2B7 OS=Homo sa... 29 6.4
sp|Q73HW5|SYFB_WOLPM Phenylalanyl-tRNA synthetase beta chain OS=... 29 6.4
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus nor... 29 6.4
sp|Q5JH71|GLMS_PYRKO Glucosamine--fructose-6-phosphate aminotran... 29 6.4
sp|Q5GSH5|SYFB_WOLTR Phenylalanyl-tRNA synthetase beta chain OS=... 29 8.3
sp|P34756|FAB1_YEAST 1-phosphatidylinositol-3-phosphate 5-kinase... 29 8.3
sp|A5FWI5|ASSY_ACICJ Argininosuccinate synthase OS=Acidiphilium ... 29 8.3

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 99.0 bits (245), Expect = 7e-21
Identities = 55/132 (41%), Positives = 75/132 (56%), Gaps = 1/132 (0%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
+VD+ AS ATP + F Y +FG V +G+ +I G G + +KT G LKDVR
Sbjct: 295 VVDTAASHHATPVRDLFCRYVAGDFGTVKMGNTSYSKIAGIGDICIKTNVGCTLVLKDVR 354

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVS-TQPSAC 39
HVP LR NLI LD +G+ F N++W+++KGSLV+AKG GTLY Q
Sbjct: 355 HVPDLRMNLISGIALDRDGYESYFANQKWRLTKGSLVIAKGVARGTLYRTNAEICQGELN 414

Query: 38 GATTEVDIAVWH 3
A E+ + +WH
Sbjct: 415 AAQDEISVDLWH 426


>sp|P25601|YCH5_YEAST Putative transposon Ty5-1 protein YCL075W
OS=Saccharomyces cerevisiae GN=TY5B PE=4 SV=1
Length = 146

Score = 30.4 bits (67), Expect = 2.9
Identities = 21/70 (30%), Positives = 33/70 (47%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
I D+G + + F + +S+ G + I+G GTV++ T +L DV
Sbjct: 80 IFDTGCTSHMCHDRSIFSSFTRSSRKDFVRGVGGSIPIMGSGTVNIGTV-----QLHDVS 134

Query: 215 HVPSLRKNLI 186
+VP L NLI
Sbjct: 135 YVPDLPVNLI 144


>sp|Q6JAN0|GPR98_DANRE G-protein coupled receptor 98 OS=Danio rerio
GN=gpr98 PE=2 SV=1
Length = 6199

Score = 30.4 bits (67), Expect = 2.9
Identities = 35/129 (27%), Positives = 53/129 (41%), Gaps = 4/129 (3%)
Frame = -3

Query: 383 GASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVRHVPS 204
G F ATP I+F D + F V + DD E G T + AN +
Sbjct: 2988 GLDFNATPSMIYFVDGERHKFIEVQILDDAVPE--GGETFQLILANPSAGL--------Q 3037

Query: 203 LRKNLIFTGQL--DDEGHN-IAFGN-KRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
L +N T + +D+GH I+F N + + + + + V G V TLY+ + P
Sbjct: 3038 LGENTTATVMILANDDGHGIISFNNSEHFLLREPTSVSGLGTSVATLYI--IRDPPQGTF 3095

Query: 35 ATTEVDIAV 9
T V +
Sbjct: 3096 GTVTVQFTI 3104


>sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo
sapiens GN=SLC16A13 PE=2 SV=1
Length = 426

Score = 30.0 bits (66), Expect = 3.7
Identities = 20/70 (28%), Positives = 33/70 (47%)
Frame = +3

Query: 156 VTFIVQLSCKDQIFAKRRNMPNIFKLPFISVSSFDRNCTFADNLTSFIISQVYIPKITLV 335
+TF L+C F++RR++ L + +SSF TFA + + + LV
Sbjct: 120 LTFAPTLACLSCYFSRRRSLATGLALTGVGLSSF----TFAPFFQWLLSHYAWRGSLLLV 175

Query: 336 VVLEMYLVWC 365
L ++LV C
Sbjct: 176 SALSLHLVAC 185


>sp|O43078|SUR2_SCHPO Protein sur2 OS=Schizosaccharomyces pombe
GN=sur2 PE=1 SV=1
Length = 660

Score = 29.6 bits (65), Expect = 4.9
Identities = 23/96 (23%), Positives = 43/96 (44%)
Frame = +1

Query: 19 STSVVAPQAEGCVLTVHK*SVPTFSPLATTKDPFEIFHRLFPNAML*PSSSNCPVKIKFL 198
STS + + G + S P SP +DPF F+ + + +S + L
Sbjct: 153 STSSIVSSSYGDAPSYLAPSKPNRSPPLKPEDPFASFNS--SASAIAAASKSAAASASAL 210

Query: 199 RREGTCLTSLSFHSFPLAVLTETVPLPTISQASSSP 306
+ +++ +FP A+ +++ PT+S + SSP
Sbjct: 211 SSDTGRSATMNSTTFPTAMKSQSTTKPTLSNSVSSP 246


>sp|Q708S7|ACC2B_DANRE Amiloride-sensitive cation channel 2-B,
neuronal OS=Danio rerio GN=accn2b PE=1 SV=1
Length = 501

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/35 (42%), Positives = 22/35 (62%)
Frame = +2

Query: 263 KLYLCRQSHKLHHLPSIHTQNYSCCSLGNVSCVVS 367
K LCR S+K HH + +T + + SL +V+C VS
Sbjct: 464 KYRLCRCSNKKHHNNNNNTDHNAVFSLDDVNCHVS 498


>sp|P16662|UD2B7_HUMAN UDP-glucuronosyltransferase 2B7 OS=Homo
sapiens GN=UGT2B7 PE=1 SV=1
Length = 529

Score = 29.3 bits (64), Expect = 6.4
Identities = 14/47 (29%), Positives = 21/47 (44%)
Frame = +3

Query: 186 DQIFAKRRNMPNIFKLPFISVSSFDRNCTFADNLTSFIISQVYIPKI 326
D IF + +F +PF+ SF TF + FI Y+P +
Sbjct: 151 DAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVV 197


>sp|Q73HW5|SYFB_WOLPM Phenylalanyl-tRNA synthetase beta chain
OS=Wolbachia pipientis wMel GN=pheT PE=3 SV=1
Length = 779

Score = 29.3 bits (64), Expect = 6.4
Identities = 20/77 (25%), Positives = 33/77 (42%)
Frame = -3

Query: 392 VDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVRH 213
V S S + K+ F + + FG V + DE +I+ K S+ W ++
Sbjct: 384 VVSAGSLDSADTKVSFDYQDVNKFGSVSVSPDEVLDILTKLGFSIDKKTEGNWNVQ---- 439

Query: 212 VPSLRKNLIFTGQLDDE 162
VPS R ++ L +E
Sbjct: 440 VPSWRPDVTIPADLIEE 456


>sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus
norvegicus GN=Slc16a13 PE=2 SV=1
Length = 428

Score = 29.3 bits (64), Expect = 6.4
Identities = 19/70 (27%), Positives = 34/70 (48%)
Frame = +3

Query: 156 VTFIVQLSCKDQIFAKRRNMPNIFKLPFISVSSFDRNCTFADNLTSFIISQVYIPKITLV 335
+TF L+C + F++RR++ L + +SSF FA + + + + LV
Sbjct: 120 LTFTPTLACLSRYFSQRRSLAMGLALTGVGISSF----AFAPLFQWLLNNYAWRGALLLV 175

Query: 336 VVLEMYLVWC 365
L ++LV C
Sbjct: 176 SALSLHLVAC 185


>sp|Q5JH71|GLMS_PYRKO Glucosamine--fructose-6-phosphate
aminotransferase [isomerizing] OS=Pyrococcus
kodakaraensis GN=glmS PE=3 SV=3
Length = 602

Score = 29.3 bits (64), Expect = 6.4
Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 11/72 (15%)
Frame = -3

Query: 311 YLGDDEACEIVGKG----------TVSVKTANGNEWKL-KDVRHVPSLRKNLIFTGQLDD 165
Y+GD +ACE++ KG + V T NG + K + L + L G L+
Sbjct: 7 YIGDRKACEVIVKGLKRLEYRGYDSAGVVTGNGETLDVRKGAGRIDKLTEKL---GFLEM 63

Query: 164 EGHNIAFGNKRW 129
EG N G+ RW
Sbjct: 64 EG-NRGIGHTRW 74


tr_hit_id A7R7G1
Definition tr|A7R7G1|A7R7G1_VITVI Chromosome undetermined scaffold_1754, whole genome shotgun sequence OS=Vitis vinifera
Align length 131
Score (bit) 130.0
E-value 2.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913828|Adiantum capillus-veneris mRNA, clone:
YMU001_000035_G10.
(397 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7R7G1|A7R7G1_VITVI Chromosome undetermined scaffold_1754, wh... 130 2e-29
tr|A7QG92|A7QG92_VITVI Chromosome undetermined scaffold_91, whol... 130 2e-29
tr|A5CBM1|A5CBM1_VITVI Putative uncharacterized protein OS=Vitis... 130 2e-29
tr|A5BPB3|A5BPB3_VITVI Putative uncharacterized protein OS=Vitis... 130 2e-29
tr|A5BGX3|A5BGX3_VITVI Putative uncharacterized protein OS=Vitis... 130 2e-29
tr|A5BA89|A5BA89_VITVI Putative uncharacterized protein OS=Vitis... 130 2e-29
tr|A5B0C8|A5B0C8_VITVI Putative uncharacterized protein OS=Vitis... 130 2e-29
tr|A5AQN2|A5AQN2_VITVI Putative uncharacterized protein OS=Vitis... 130 2e-29
tr|A5B0V5|A5B0V5_VITVI Putative uncharacterized protein OS=Vitis... 130 3e-29
tr|A7NUU2|A7NUU2_VITVI Chromosome chr18 scaffold_1, whole genome... 129 6e-29
tr|A5C844|A5C844_VITVI Putative uncharacterized protein OS=Vitis... 129 6e-29
tr|A5BIC7|A5BIC7_VITVI Putative uncharacterized protein OS=Vitis... 129 6e-29
tr|A5AVU6|A5AVU6_VITVI Putative uncharacterized protein OS=Vitis... 129 6e-29
tr|A5AS37|A5AS37_VITVI Putative uncharacterized protein OS=Vitis... 129 6e-29
tr|A5AK46|A5AK46_VITVI Putative uncharacterized protein OS=Vitis... 129 6e-29
tr|A5C6L3|A5C6L3_VITVI Putative uncharacterized protein OS=Vitis... 128 1e-28
tr|A5B6M5|A5B6M5_VITVI Putative uncharacterized protein OS=Vitis... 128 1e-28
tr|A5B0E4|A5B0E4_VITVI Putative uncharacterized protein OS=Vitis... 128 1e-28
tr|A7NW85|A7NW85_VITVI Chromosome chr5 scaffold_2, whole genome ... 128 2e-28
tr|A5BJQ3|A5BJQ3_VITVI Putative uncharacterized protein OS=Vitis... 128 2e-28
tr|A5AN26|A5AN26_VITVI Putative uncharacterized protein OS=Vitis... 128 2e-28
tr|A5CAX7|A5CAX7_VITVI Putative uncharacterized protein OS=Vitis... 127 2e-28
tr|A5BKD2|A5BKD2_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|A5ATI4|A5ATI4_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|A5BWL7|A5BWL7_VITVI Putative uncharacterized protein OS=Vitis... 126 5e-28
tr|A5AMT8|A5AMT8_VITVI Putative uncharacterized protein OS=Vitis... 126 5e-28
tr|A5ASH8|A5ASH8_VITVI Putative uncharacterized protein OS=Vitis... 126 6e-28
tr|A5BPZ5|A5BPZ5_VITVI Putative uncharacterized protein OS=Vitis... 125 8e-28
tr|A5B5N4|A5B5N4_VITVI Putative uncharacterized protein OS=Vitis... 125 8e-28
tr|A5AMG2|A5AMG2_VITVI Putative uncharacterized protein OS=Vitis... 125 8e-28

>tr|A7R7G1|A7R7G1_VITVI Chromosome undetermined scaffold_1754, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00009987001 PE=4 SV=1
Length = 466

Score = 130 bits (328), Expect = 2e-29
Identities = 62/131 (47%), Positives = 85/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 227 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 286

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 287 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRDTIAV 345

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 346 ADASTDTSLWH 356


>tr|A7QG92|A7QG92_VITVI Chromosome undetermined scaffold_91, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00037749001 PE=4 SV=1
Length = 788

Score = 130 bits (328), Expect = 2e-29
Identities = 62/131 (47%), Positives = 85/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 570 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 629

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 630 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRDTIAV 688

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 689 ADASTDTSLWH 699


>tr|A5CBM1|A5CBM1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_001479 PE=4 SV=1
Length = 1246

Score = 130 bits (328), Expect = 2e-29
Identities = 62/131 (47%), Positives = 85/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 259 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 318

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 319 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRDTIAV 377

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 378 ADASTDTSLWH 388


>tr|A5BPB3|A5BPB3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034935 PE=4 SV=1
Length = 1137

Score = 130 bits (328), Expect = 2e-29
Identities = 62/131 (47%), Positives = 85/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 241 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 300

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 301 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRDTIAV 359

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 360 ADASTDTSLWH 370


>tr|A5BGX3|A5BGX3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003944 PE=4 SV=1
Length = 1236

Score = 130 bits (328), Expect = 2e-29
Identities = 62/131 (47%), Positives = 85/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 287 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 346

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 347 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRDTIAV 405

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 406 ADASTDTSLWH 416


>tr|A5BA89|A5BA89_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_043997 PE=4 SV=1
Length = 1269

Score = 130 bits (328), Expect = 2e-29
Identities = 62/131 (47%), Positives = 85/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 287 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 346

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 347 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRDTIAV 405

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 406 ADASTDTSLWH 416


>tr|A5B0C8|A5B0C8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_015834 PE=4 SV=1
Length = 1186

Score = 130 bits (328), Expect = 2e-29
Identities = 62/131 (47%), Positives = 85/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 56 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 115

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 116 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRDTIAV 174

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 175 ADASTDTSLWH 185


>tr|A5AQN2|A5AQN2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_036909 PE=4 SV=1
Length = 1032

Score = 130 bits (328), Expect = 2e-29
Identities = 62/131 (47%), Positives = 85/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 210 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 269

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 270 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRDTIAV 328

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 329 ADASTDTSLWH 339


>tr|A5B0V5|A5B0V5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_008497 PE=4 SV=1
Length = 1149

Score = 130 bits (327), Expect = 3e-29
Identities = 63/131 (48%), Positives = 84/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y FG VYL D A +IVG G V + NG+ W L+ VR
Sbjct: 250 VLDSGASFHTTPHREIIQNYVAGGFGKVYLADGSALDIVGLGDVRISLPNGSVWLLEKVR 309

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG+ V+A+G+K GTLY+ T + +
Sbjct: 310 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGARVLARGKKTGTLYM-TSCPRNTIAV 368

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 369 ADVSTDTSLWH 379


>tr|A7NUU2|A7NUU2_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015182001
PE=4 SV=1
Length = 379

Score = 129 bits (325), Expect = 6e-29
Identities = 62/131 (47%), Positives = 84/131 (64%)
Frame = -3

Query: 395 IVDSGASFRATPHKIHFQDYNKSNFGYVYLGDDEACEIVGKGTVSVKTANGNEWKLKDVR 216
++DSGASF TPH+ Q+Y +FG VYL D A ++VG G V + NG+ W L+ VR
Sbjct: 243 VLDSGASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 302

Query: 215 HVPSLRKNLIFTGQLDDEGHNIAFGNKRWKISKGSLVVAKGEKVGTLYLCTVSTQPSACG 36
H+P LR+NLI GQLDDEGH I F WK++KG V+A+G+K GTLY+ T + +
Sbjct: 303 HIPDLRRNLISVGQLDDEGHAILFVGGTWKVTKGVRVLARGKKTGTLYM-TSCPRDTIAV 361

Query: 35 ATTEVDIAVWH 3
A D ++WH
Sbjct: 362 ADASTDTSLWH 372