BP913832
Clone id YMU001_000035_H03
Library
Length 560
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000035_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAAGGACCGAAGATTACATGGCCACAACTGCTACATCTTGTACCTAAAGTAAGGCGACAA
TGGTCTAAAATGGTAAGTACAAGACGCTCCAAAACAAAGGTAGCCGGAGCAATTTCGGGA
TCAACATGGATGACATCCTTCCAATTGTCGACGTAAACATAAAAGGAAAGAGGGTTGGAA
ACACCTACATTGATGGATGTCACAAATCTGTGTAATGAGCGAAGCTATGATGCTTCAATT
AGGGCTCGAGGTTGACAGGCCTTCTCCATGCAAGGCAAAGATGGCAAACAACGCAAAAGT
AAAGTGTGTGGGTGTGGTAAGTGCCGTGAAAATCAAAGCTTTCAACACTGAGGTAGAGGT
AGATGTTTTTGTAATGCCTACTAAGGGGGAGGGCTATCCACTAATTTTGGGAAGGCCATG
GTTGATGGCCATGAAAGCAAAGCACGACTGGGGTACTGGCCTTCTACGCATGACCGGTAA
GAAAGGGGAGACAATCTACTACGACATGAGGATTGGCAAGCAGAAGCAAATGAATCTGGA
AACATCGGCAGATGAAACCA
■■Homology search results ■■ -
sp_hit_id Q9ZFA3
Definition sp|Q9ZFA3|SYE_RHOS4 Glutamyl-tRNA synthetase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Align length 58
Score (bit) 32.0
E-value 2.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913832|Adiantum capillus-veneris mRNA, clone:
YMU001_000035_H03.
(560 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9ZFA3|SYE_RHOS4 Glutamyl-tRNA synthetase OS=Rhodobacter spha... 32 2.1
sp|Q1GHK0|SYE_SILST Glutamyl-tRNA synthetase OS=Silicibacter sp.... 30 6.2
sp|A8LMK2|SYE_DINSH Glutamyl-tRNA synthetase OS=Dinoroseobacter ... 30 8.1

>sp|Q9ZFA3|SYE_RHOS4 Glutamyl-tRNA synthetase OS=Rhodobacter
sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM
158) GN=gltX PE=3 SV=1
Length = 471

Score = 32.0 bits (71), Expect = 2.1
Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
Frame = +2

Query: 335 KAFNTEVEVDVFVMPTKGEGYPLILGRPWLMAMKAKHDWGTGLLRMTG-KKGETIYYD 505
K F+T+ E++ F + EG + PW A H ++RM + GET+ D
Sbjct: 103 KCFSTQEEIEAFRESARAEGRSTLFRSPWRDADPTSHPDAPFVIRMKAPRSGETVIED 160


>sp|Q1GHK0|SYE_SILST Glutamyl-tRNA synthetase OS=Silicibacter sp.
(strain TM1040) GN=gltX PE=3 SV=1
Length = 466

Score = 30.4 bits (67), Expect = 6.2
Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
Frame = +2

Query: 335 KAFNTEVEVDVFVMPTKGEGYPLILGRPWLMAMKAKHDWGTGLLRMTG-KKGETIYYD 505
K F+T+ E+ F K EG + PW +++H +R+ K GET+ D
Sbjct: 99 KCFSTQEEIAAFREAAKAEGKSTLFHSPWRDTPESEHPDAPFAIRIKAPKDGETVIRD 156


>sp|A8LMK2|SYE_DINSH Glutamyl-tRNA synthetase OS=Dinoroseobacter
shibae (strain DFL 12) GN=gltX PE=3 SV=1
Length = 471

Score = 30.0 bits (66), Expect = 8.1
Identities = 26/101 (25%), Positives = 44/101 (43%), Gaps = 2/101 (1%)
Frame = +2

Query: 239 LGLEVDRPSPCKAK-MANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMPTKGEGYPLILGR 415
LGL+ D + +A+ A +A+V + K F T+ E+ F + EG +
Sbjct: 70 LGLDWDGDAVSQAEGAARHAQVARALQEAGKAYKCFTTQDEIAAFREAARAEGRSTLFRS 129

Query: 416 PWLMAMKAKHDWGTGLLRMTG-KKGETIYYDMRIGKQKQMN 535
PW A A H ++R+ ++G T+ D G + N
Sbjct: 130 PWRDADPASHPDAPYVIRIKAPQEGTTVIADQVQGDVRIRN 170


tr_hit_id Q2R8K8
Definition tr|Q2R8K8|Q2R8K8_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica
Align length 92
Score (bit) 47.8
E-value 0.0004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913832|Adiantum capillus-veneris mRNA, clone:
YMU001_000035_H03.
(560 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2R8K8|Q2R8K8_ORYSJ Putative uncharacterized protein OS=Oryza... 48 4e-04
tr|A9TM18|A9TM18_PHYPA Predicted protein OS=Physcomitrella paten... 47 0.001
tr|Q7XRT2|Q7XRT2_ORYSJ OSJNBa0042F21.11 protein OS=Oryza sativa ... 46 0.002
tr|Q01M69|Q01M69_ORYSA OSIGBa0114M03.4 protein OS=Oryza sativa G... 45 0.003
tr|Q75H42|Q75H42_ORYSJ Putative uncharacterized protein OSJNBa00... 44 0.005
tr|Q6UUE9|Q6UUE9_ORYSJ Putative uncharacterized protein (Putativ... 44 0.005
tr|A9T9T9|A9T9T9_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.005
tr|Q8RVC8|Q8RVC8_ORYSJ Putative polyprotein OS=Oryza sativa subs... 44 0.006
tr|A9TY16|A9TY16_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.006
tr|A9T873|A9T873_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.006
tr|A9TL34|A9TL34_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.008
tr|A9T8V3|A9T8V3_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.008
tr|Q94HV4|Q94HV4_ORYSA Putative retroelement OS=Oryza sativa GN=... 43 0.010
tr|Q7XFZ5|Q7XFZ5_ORYSJ Os10g0317000 protein OS=Oryza sativa subs... 43 0.010
tr|Q53KJ4|Q53KJ4_ORYSJ Transposable element protein, putative, R... 43 0.010
tr|A9U1C8|A9U1C8_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.010
tr|A9TXN1|A9TXN1_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.010
tr|A9T5Z4|A9T5Z4_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.010
tr|A9RIU0|A9RIU0_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.010
tr|A9RCE7|A9RCE7_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.010
tr|A9T4A9|A9T4A9_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.013
tr|A9SU09|A9SU09_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.013
tr|Q9XH31|Q9XH31_ARATH Putative athila transposon protein OS=Ara... 42 0.017
tr|Q947Y6|Q947Y6_ORYSA Putative retroelement OS=Oryza sativa GN=... 42 0.017
tr|Q10RT1|Q10RT1_ORYSJ Retrotransposon protein, putative, unclas... 42 0.017
tr|A9TX89|A9TX89_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.017
tr|A9RIE9|A9RIE9_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.017
tr|A9TWI6|A9TWI6_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.023
tr|A9TVQ9|A9TVQ9_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.023
tr|A9SU86|A9SU86_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.023

>tr|Q2R8K8|Q2R8K8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=LOC_Os11g11840 PE=4 SV=1
Length = 491

Score = 47.8 bits (112), Expect = 4e-04
Identities = 29/92 (31%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
Frame = +2

Query: 200 SQICVMSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMP 379
+ + VM + + +L V P+P + ++AN++ G+ V +K + + VD V+
Sbjct: 300 ASVSVMPKDVFDKLNFTVLTPTPMRLQLANSSVRYPAGIAEDVPVKIRDFFIPVDFVVLD 359

Query: 380 TK-GEGYPLILGRPWLMAMKAKHDWGTGLLRM 472
G+ PLILGRP+L + A D GTG +R+
Sbjct: 360 MDTGKEKPLILGRPFLSTVGANIDVGTGSIRL 391


>tr|A9TM18|A9TM18_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_94508 PE=4 SV=1
Length = 992

Score = 46.6 bits (109), Expect = 0.001
Identities = 36/118 (30%), Positives = 55/118 (46%), Gaps = 2/118 (1%)
Frame = +2

Query: 200 SQICVMSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMP 379
S+I +MS+ + + +D + ANN + + G VKI+ + E FV
Sbjct: 118 SEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELYGACPDVKIRIGDVATEQHFFVQD 177

Query: 380 TKGEGYPLILGRPWLMA--MKAKHDWGTGLLRMTGKKGETIYYDMRIGKQKQMNLETS 547
T YPLILG+P++ A M+ K D+G G K E + D G + + L TS
Sbjct: 178 T--TSYPLILGQPYITATRMETKRDYG-------GTKEEVLLRDEENGLEDSLELITS 226


>tr|Q7XRT2|Q7XRT2_ORYSJ OSJNBa0042F21.11 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0042F21.11 PE=4 SV=2
Length = 920

Score = 45.8 bits (107), Expect = 0.002
Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 3/108 (2%)
Frame = +2

Query: 200 SQICVMSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAV--KIKAFNTEVEVDVFV 373
+ + VM + + +L V P+P + ++A+++ VG+ V KI+ F V+ V
Sbjct: 780 ASVSVMPKDVFDKLNFTVLAPTPMRLQLADSSVHYPVGIAEDVPAKIRDFFIPVDFVVLD 839

Query: 374 MPTKGEGYPLILGRPWLMAMKAKHDWGTGLLRM-TGKKGETIYYDMRI 514
M T G+ PLILGRP+L A D GTG +R T K E + R+
Sbjct: 840 MDT-GKETPLILGRPFLSTAGANIDVGTGSIRFHTNGKEEKFEFQPRM 886


>tr|Q01M69|Q01M69_ORYSA OSIGBa0114M03.4 protein OS=Oryza sativa
GN=OSIGBa0114M03.4 PE=4 SV=1
Length = 1448

Score = 44.7 bits (104), Expect = 0.003
Identities = 24/73 (32%), Positives = 37/73 (50%)
Frame = +2

Query: 215 MSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMPTKGEG 394
+SEA + GL + + A +AN +V C+GV+ + D+FVMP G
Sbjct: 363 ISEAAAQRSGLPLQQRPRLTAMVANGERVTCIGVIRGAPLTIGGNSFPADLFVMPL--AG 420

Query: 395 YPLILGRPWLMAM 433
Y ++LG WL A+
Sbjct: 421 YDVVLGTRWLGAL 433


>tr|Q75H42|Q75H42_ORYSJ Putative uncharacterized protein
OSJNBa0006O14.11 (Putative uncharacterized protein
OSJNBa0010H19.4) OS=Oryza sativa subsp. japonica
GN=OSJNBa0006O14.11 PE=4 SV=1
Length = 256

Score = 44.3 bits (103), Expect = 0.005
Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
Frame = +2

Query: 200 SQICVMSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMP 379
+ + VM + + +L V P+P ++A+++ G+V V +K N + VD V+
Sbjct: 70 ASVSVMPKNVFDKLNFMVLAPTPMCLQLADSSVRYPAGIVEDVPVKIRNFFIPVDFVVLD 129

Query: 380 TK-GEGYPLILGRPWLMAMKAKHDWGTG 460
G+ PLILGRP+L A D GTG
Sbjct: 130 MDMGKETPLILGRPFLSTAGANSDVGTG 157


>tr|Q6UUE9|Q6UUE9_ORYSJ Putative uncharacterized protein (Putative
retrotransposon) OS=Oryza sativa subsp. japonica
GN=OSJNBa0024A05.1 PE=4 SV=1
Length = 795

Score = 44.3 bits (103), Expect = 0.005
Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 1/120 (0%)
Frame = +2

Query: 200 SQICVMSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMP 379
+ I VMS+ + +L V P+P + A+++ G+ V +K + + VD V+
Sbjct: 389 ASISVMSKDVFDKLNFTVLAPTPMCLQQADSSIRYPAGIAEDVLVKIRDFFISVDFVVLD 448

Query: 380 TK-GEGYPLILGRPWLMAMKAKHDWGTGLLRMTGKKGETIYYDMRIGKQKQMNLETSADE 556
G+ PLILGRP+L A D GTG +IY+ + GK+K+ + ++
Sbjct: 449 MDTGKETPLILGRPFLSTAGANIDMGTG----------SIYFHIN-GKEKKFEFQPRTEQ 497


>tr|A9T9T9|A9T9T9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_89954 PE=4 SV=1
Length = 552

Score = 44.3 bits (103), Expect = 0.005
Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 3/115 (2%)
Frame = +2

Query: 200 SQICVMSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMP 379
S+I +MS+ + + +D + ANN + K G VKI+ + E F+
Sbjct: 392 SEINLMSKDLYKKQKWPIDMEHGWIIRAANNTRGKLYGACPDVKIRIGDVATEQHFFIQD 451

Query: 380 TKGEGYPLILGRPWLMAMKAKH---DWGTGLLRMTGKKGETIYYDMRIGKQKQMN 535
T YPLILG+P++MA + + D G+ R+ K G + + + + N
Sbjct: 452 TTS--YPLILGQPYIMATRMETKVLDDGSAYARVRSKDGRKVVQFLTVPPNHERN 504


>tr|Q8RVC8|Q8RVC8_ORYSJ Putative polyprotein OS=Oryza sativa subsp.
japonica GN=OSJNBa0049K09.5 PE=4 SV=1
Length = 689

Score = 43.9 bits (102), Expect = 0.006
Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
Frame = +2

Query: 200 SQICVMSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMP 379
+ + V+ + + +L V P+P + ++A+++ G+ V +K + + VD V+
Sbjct: 503 ASVSVVLKDVFDKLNFTVLAPTPMRLQLADSSVRYPAGIAEDVPVKIRDFFIPVDFVVLD 562

Query: 380 TK-GEGYPLILGRPWLMAMKAKHDWGTGLLR--MTGKK 484
G+ PLILGRP+L A D GTG +R + GKK
Sbjct: 563 MDTGKETPLILGRPFLSTAGANIDVGTGSIRFHINGKK 600


>tr|A9TY16|A9TY16_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_98789 PE=4 SV=1
Length = 455

Score = 43.9 bits (102), Expect = 0.006
Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 3/115 (2%)
Frame = +2

Query: 200 SQICVMSEAMMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMP 379
S+I +MS+ + + +D + ANN + K G VKI+ + E FV
Sbjct: 319 SEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGKLYGACPDVKIRIGDVATEQHFFVQD 378

Query: 380 TKGEGYPLILGRPWLMAMKAKH---DWGTGLLRMTGKKGETIYYDMRIGKQKQMN 535
T YPLILG+P++MA + + D G+ R+ + G + + + + N
Sbjct: 379 T--TSYPLILGQPYIMATRMETKVLDDGSAYARVRSEDGRKVVQFLTVPPNHERN 431


>tr|A9T873|A9T873_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_89365 PE=4 SV=1
Length = 609

Score = 43.9 bits (102), Expect = 0.006
Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 3/106 (2%)
Frame = +2

Query: 227 MMLQLGLEVDRPSPCKAKMANNAKVKCVGVVSAVKIKAFNTEVEVDVFVMPTKGEGYPLI 406
++++LG +++ P ANN + + G + VK++ + E FV T YPLI
Sbjct: 292 VLVKLG-DIEEPIVALVDHANNTRGELYGAIPDVKVRIGDVATEQHFFVQDTTS--YPLI 348

Query: 407 LGRPWLMAMKAKH---DWGTGLLRMTGKKGETIYYDMRIGKQKQMN 535
LG+P++MA + + D G+ R+ K G + + + + N
Sbjct: 349 LGQPYIMATRMETKVLDDGSAYARVHSKDGRKVVQFLTVPPNHERN 394