BP913840
Clone id YMU001_000037_A01
Library
Length 410
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_A01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATAATTTCACACGCACAGAGTACAGATTCCCCCTCTCTCATCTCTCTTCTAATTAGCTC
GGTTTTTTTAAAAGCGATCTTATCCGTATTTTCTGCCAGCTTCCGGCAAATAATAGTCCC
CTTCATATTTCAAGCGTCCTTGTATTGTCGGTCGTTGATCGATTACAGTTAACTGTATAC
CCATACCCTAGAGTCACATTCTTTGTTCTTCTGAAGTCCTTCACTCAAATCCTTACAGCA
GAGAAACCATTTAATTAGTAGCAGTCATCATCATCATCATGCACTACATCTGCCCCTCTG
CAAATGAAGGATGTAGCAGCTTGCAAAGGTCCTGCAGCTTCAATGGTGACCGCCAGAGGA
ATATCCTAAGCATCAATTCCACTACCAGCAATACATTATGCACATCCATG
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913840|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_A01.
(410 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id Q9M1T2
Definition tr|Q9M1T2|Q9M1T2_ARATH Putative uncharacterized protein T5N23_40 OS=Arabidopsis thaliana
Align length 37
Score (bit) 33.1
E-value 7.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913840|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_A01.
(410 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9M1T2|Q9M1T2_ARATH Putative uncharacterized protein T5N23_40... 33 7.1

>tr|Q9M1T2|Q9M1T2_ARATH Putative uncharacterized protein T5N23_40
OS=Arabidopsis thaliana GN=T5N23_40 PE=4 SV=1
Length = 259

Score = 33.1 bits (74), Expect = 7.1
Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
Frame = +3

Query: 285 YICPSANEGCSSLQRSC-SFNGDRQRNILSINSTTSN 392
Y+ PS N CSS+ R C F QRN L I ST+S+
Sbjct: 213 YVHPSRNNRCSSITRECLGFLALPQRNYLEIYSTSSH 249