BP913845
Clone id YMU001_000037_A06
Library
Length 496
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_A06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGGTGGGATCGTGTCGGCCATAGTCTAGTAGGAGTGGTTGACAACAGACACAGTAAGGTA
GCAGAGGTAGGCCCAGTCTATCCTTGTTTACAAGAGGAGAGTTGAGAGAGTTGTTCATGG
TGATGAGCTTTCTCCTCCAGATGTGAGAGAGCCTGTGTTTGGACCAGAGGCTCACCAAAA
TTATACCAGCAGCCTTTGGAGCAGCCAGGGGTTAATGGCAGAGCCCAGCAGTTAGGCCAC
AGTTAAACGTCCCTCTGCCAGAAGACGGTTATATTCTGAAATCCTTTGCAACGCATGCCT
CTCTTTAATGCATAAGTTGCATGGACAGCAGCTTGACCATAACAGACGGTCGATTAAAAC
AAATAGCACCATCAAAATAAAGATCAACATGTAAGGCTTGGTGCCACAAACAAAGTTGGC
ACCAGTGCAAAAATAATAGAACAGTATCATACACAGTATGCCTAAACCTTATTTGACAAA
TGACATATAAATGAAT
■■Homology search results ■■ -
sp_hit_id Q47WP5
Definition sp|Q47WP5|RNC_COLP3 Ribonuclease 3 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Align length 34
Score (bit) 32.0
E-value 1.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913845|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_A06.
(496 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q47WP5|RNC_COLP3 Ribonuclease 3 OS=Colwellia psychrerythraea ... 32 1.6
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS... 32 2.1
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Sacch... 32 2.1
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS... 31 2.8
sp|P69168|COATA_BPM13 Coat protein A OS=Enterobacteria phage M13... 30 4.7
sp|O05975|Y785_RICPR Uncharacterized protein RP785 OS=Rickettsia... 30 6.0
sp|P69169|COATA_BPF1 Coat protein A OS=Enterobacteria phage f1 G... 30 6.1
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN... 30 8.0
sp|P03661|COATA_BPFD Coat protein A OS=Enterobacteria phage fd G... 30 8.0

>sp|Q47WP5|RNC_COLP3 Ribonuclease 3 OS=Colwellia psychrerythraea
(strain 34H / ATCC BAA-681) GN=rnc PE=3 SV=1
Length = 266

Score = 32.0 bits (71), Expect = 1.6
Identities = 15/34 (44%), Positives = 20/34 (58%)
Frame = -3

Query: 200 SKGCWYNFGEPLVQTQALSHLEEKAHHHEQLSQL 99
+K Y F EPL+ QAL+H K H+E+L L
Sbjct: 12 TKKLGYEFNEPLLLVQALTHRSAKGAHNERLEFL 45


>sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2
OS=Mus musculus GN=Gata2 PE=2 SV=2
Length = 480

Score = 31.6 bits (70), Expect = 2.1
Identities = 25/80 (31%), Positives = 33/80 (41%), Gaps = 21/80 (26%)
Frame = +2

Query: 152 PVFGPEAHQNYTSSLWSSQGLMAEPSS*ATVKR---------------------PSARRR 268
P + P A +Y SSL+ G + P+S T K+ P RR
Sbjct: 250 PSYVPAAAHDYGSSLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRD 309

Query: 269 LYSEILCNACLSLMHKLHGQ 328
LCNAC L HK++GQ
Sbjct: 310 GTGHYLCNAC-GLYHKMNGQ 328


>sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80
OS=Saccharomyces cerevisiae GN=DAL80 PE=1 SV=1
Length = 269

Score = 31.6 bits (70), Expect = 2.1
Identities = 16/30 (53%), Positives = 19/30 (63%)
Frame = +2

Query: 239 TVKRPSARRRLYSEILCNACLSLMHKLHGQ 328
TVK P RR + +LCNAC L KLHG+
Sbjct: 36 TVKTPLWRRDEHGTVLCNAC-GLFLKLHGE 64


>sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2
OS=Homo sapiens GN=GATA2 PE=2 SV=2
Length = 480

Score = 31.2 bits (69), Expect = 2.8
Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 21/80 (26%)
Frame = +2

Query: 152 PVFGPEAHQNYTSSLWSSQGLMAEPSS*ATVKR---------------------PSARRR 268
P + P A +Y+S L+ G + P+S T K+ P RR
Sbjct: 250 PSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRD 309

Query: 269 LYSEILCNACLSLMHKLHGQ 328
LCNAC L HK++GQ
Sbjct: 310 GTGHYLCNAC-GLYHKMNGQ 328


>sp|P69168|COATA_BPM13 Coat protein A OS=Enterobacteria phage M13
GN=III PE=1 SV=1
Length = 424

Score = 30.4 bits (67), Expect = 4.7
Identities = 14/30 (46%), Positives = 18/30 (60%)
Frame = -1

Query: 103 NSPLVNKDRLGLPLLPYCVCCQPLLLDYGR 14
NSPL+N R LP LP V C+P + G+
Sbjct: 352 NSPLMNNFRQYLPSLPQSVECRPFVFSAGK 381


>sp|O05975|Y785_RICPR Uncharacterized protein RP785 OS=Rickettsia
prowazekii GN=RP785 PE=4 SV=2
Length = 1169

Score = 30.0 bits (66), Expect = 6.0
Identities = 12/28 (42%), Positives = 17/28 (60%)
Frame = -3

Query: 278 QNITVFWQRDV*LWPNCWALPLTPGCSK 195
QN T+ W + LWP + LPLT C++
Sbjct: 125 QNSTLNWDGECVLWPTGYGLPLTRVCAR 152


>sp|P69169|COATA_BPF1 Coat protein A OS=Enterobacteria phage f1
GN=III PE=3 SV=1
Length = 424

Score = 30.0 bits (66), Expect = 6.1
Identities = 14/30 (46%), Positives = 18/30 (60%)
Frame = -1

Query: 103 NSPLVNKDRLGLPLLPYCVCCQPLLLDYGR 14
NSPL+N R LP LP V C+P + G+
Sbjct: 352 NSPLMNNFRQYLPSLPQSVECRPFVFGAGK 381


>sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis
GN=gata2 PE=2 SV=1
Length = 452

Score = 29.6 bits (65), Expect = 8.0
Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 21/80 (26%)
Frame = +2

Query: 152 PVFGPEAHQNYTSSLWSSQGLMAEPSS*ATVKR---------------------PSARRR 268
P + P AH +Y+S L+ L+ P+S T K+ P RR
Sbjct: 223 PSYVPAAH-DYSSGLFHPGSLLGGPASSFTPKQRSKSRSCSEGRECVNCGATATPLWRRD 281

Query: 269 LYSEILCNACLSLMHKLHGQ 328
LCNAC L HK++GQ
Sbjct: 282 GTGHYLCNAC-GLYHKMNGQ 300


>sp|P03661|COATA_BPFD Coat protein A OS=Enterobacteria phage fd
GN=III PE=1 SV=1
Length = 424

Score = 29.6 bits (65), Expect = 8.0
Identities = 14/30 (46%), Positives = 18/30 (60%)
Frame = -1

Query: 103 NSPLVNKDRLGLPLLPYCVCCQPLLLDYGR 14
NSPL+N R LP LP V C+P + G+
Sbjct: 352 NSPLMNNFRQYLPSLPQSVECRPYVFGAGK 381


tr_hit_id A2ZYL8
Definition tr|A2ZYL8|A2ZYL8_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica
Align length 51
Score (bit) 36.6
E-value 0.68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913845|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_A06.
(496 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2ZYL8|A2ZYL8_ORYSJ Putative uncharacterized protein OS=Oryza... 37 0.68
tr|Q05552|Q05552_9POXV P65 OS=Ectromelia virus PE=4 SV=1 33 9.8

>tr|A2ZYL8|A2ZYL8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_003640 PE=4 SV=1
Length = 518

Score = 36.6 bits (83), Expect = 0.68
Identities = 16/51 (31%), Positives = 26/51 (50%)
Frame = -1

Query: 184 IILVSLWSKHRLSHIWRRKLITMNNSLNSPLVNKDRLGLPLLPYCVCCQPL 32
++L+S+WSKH L H WR N SP + ++ +C+ C P+
Sbjct: 24 MLLLSVWSKHGLEHHWRDVNHASTNGYGSPFAKSSHPRMMMI-FCLLCVPV 73


>tr|Q05552|Q05552_9POXV P65 OS=Ectromelia virus PE=4 SV=1
Length = 559

Score = 32.7 bits (73), Expect = 9.8
Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
Frame = -1

Query: 460 HTV-YDTVLLFLHWCQLCLWHQALHVDLYFDGAICFNR 350
HT+ +D + LHW + C+ H+D Y IC+ R
Sbjct: 509 HTILHDDAITILHWYESCMIQDKFHIDTYKWTNICYQR 546