BP913849
Clone id YMU001_000037_A11
Library
Length 510
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_A11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TCCTATGCCAAAAGAAGACAGGAATGGAGCCAGCAAGCAAACAATCGAATGTTGACCGCC
TTGTAAAACTATCCCCACGAGGCTGCAAGCAAAATGTGGAATCCATAAAAAACTCCATTG
TCTTCTGATTATCCTCACATGTTCCATTAGAACAATCCAGGGATCGGCATTGCTTTGCTT
GACTGCATTGCTTGAACAGAGTGCGTCTAAAGTCGTTCGGAAACTTGTCCCTTGGAGCTC
CTGCGAAGGAAAACAAGTAGTTCCTCTTCAATCCTTTAATGTGATTTTGCCATGCTAGCA
AATCTGAATCGCTTTGAGGGTGAAAATTGGTTGGATATGGCACACCCATCTCTTTACTAT
CCCAAGGGTTCCTCTCAATAAGGAGCTTGGTGATGTTCTGCATTGCTGGTTTAGTGAAAA
ACCCACTTCCCCAATCTTCCTCTTTAAACCTCCTAAAATCCCATGTAATTCTTCCAACCA
TCATGAAGTGATCCACGCCACCGCTGCTCT
■■Homology search results ■■ -
sp_hit_id Q8H038
Definition sp|Q8H038|KATAM_ORYSJ Xyloglucan galactosyltransferase KATAMARI1 homolog OS=Oryza sativa subsp. japonica
Align length 168
Score (bit) 180.0
E-value 3.0e-45
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913849|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_A11.
(510 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8H038|KATAM_ORYSJ Xyloglucan galactosyltransferase KATAMARI1... 180 3e-45
sp|Q7XJ98|KATAM_ARATH Xyloglucan galactosyltransferase KATAMARI1... 178 1e-44
sp|P45481|CBP_MOUSE CREB-binding protein OS=Mus musculus GN=Creb... 33 0.78
sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREB... 33 0.78
sp|Q9V730|EXT1_DROME Exostosin-1 OS=Drosophila melanogaster GN=t... 32 1.7
sp|Q3J3D0|SURE_RHOS4 5'-nucleotidase surE OS=Rhodobacter sphaero... 31 3.9
sp|A3PIZ9|SURE_RHOS1 5'-nucleotidase surE OS=Rhodobacter sphaero... 31 3.9
sp|Q8RFC2|HUTH1_FUSNN Histidine ammonia-lyase 1 OS=Fusobacterium... 30 5.0
sp|Q5K709|CAS1_CRYNE Probable O-acetyltransferase CAS1 OS=Crypto... 30 5.0
sp|Q8X226|CAS1_CRYNV Probable O-acetyltransferase CAS1 OS=Crypto... 30 6.5
sp|Q14FJ4|VMOC_ECHOC Zinc metalloproteinase/disintegrin OS=Echis... 30 6.6
sp|Q05439|OS28_PLAGA 28 kDa ookinete surface antigen OS=Plasmodi... 30 6.6
sp|P23391|LACC_LACLA Tagatose-6-phosphate kinase OS=Lactococcus ... 30 6.6
sp|P0C6R6|DISOI_ECHOC Disintegrin ocellatin OS=Echis ocellatus P... 30 6.6
sp|Q3BER1|DISOC_ECHOC Disintegrin ocellatusin OS=Echis ocellatus... 30 6.6
sp|Q9UHC1|MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sa... 30 8.6

>sp|Q8H038|KATAM_ORYSJ Xyloglucan galactosyltransferase KATAMARI1
homolog OS=Oryza sativa subsp. japonica GN=Os03g0144800
PE=2 SV=1
Length = 588

Score = 180 bits (457), Expect = 3e-45
Identities = 82/168 (48%), Positives = 110/168 (65%), Gaps = 4/168 (2%)
Frame = -3

Query: 502 GGVDHFMMVGRITWDFRRFKEE--DWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPT 329
GG DHF++ GRI WDFRR +E DWG+ PA +N++ L++E +PW++ + +PYPT
Sbjct: 259 GGRDHFLVGGRIAWDFRRLTDEESDWGNKLLFMPAAKNMSMLVVESSPWNANDFAIPYPT 318

Query: 328 NFHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQAKQCRSLDCS 149
FHP D+D+L WQ+ ++ L+R +LFSFAGAPR P R L QC + C+ L+C
Sbjct: 319 YFHPAKDADVLLWQDRMRSLERPWLFSFAGAPRPDDPKSIRSQLIDQCRTSSVCKLLECD 378

Query: 148 NG--TCEDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFF 11
G C M F +S FCLQP+GDS+TRRS FD +LAG IPVFF
Sbjct: 379 LGESKCHSPSAIMNMFQNSLFCLQPQGDSYTRRSAFDSMLAGCIPVFF 426


>sp|Q7XJ98|KATAM_ARATH Xyloglucan galactosyltransferase KATAMARI1
OS=Arabidopsis thaliana GN=KAM1 PE=1 SV=1
Length = 619

Score = 178 bits (452), Expect = 1e-44
Identities = 81/167 (48%), Positives = 109/167 (65%), Gaps = 4/167 (2%)
Frame = -3

Query: 499 GVDHFMMVGRITWDFRRFKEE--DWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
G DHF++ GRITWDFRR EE DWG+ PA +N++ L++E +PW++ + G+PYPT
Sbjct: 283 GKDHFLVAGRITWDFRRLSEEETDWGNKLLFLPAAKNMSMLVVESSPWNANDFGIPYPTY 342

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQAKQCRSLDCSN 146
FHP DS++ WQ+ ++ L+R +LFSFAGAPR P R + QC + + L+C
Sbjct: 343 FHPAKDSEVFEWQDRMRNLERKWLFSFAGAPRPDNPKSIRGQIIDQCRNSNVGKLLECDF 402

Query: 145 G--TCEDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFF 11
G C M+ F S FCLQP+GDS+TRRS FD +LAG IPVFF
Sbjct: 403 GESKCHAPSSIMQMFQSSLFCLQPQGDSYTRRSAFDSMLAGCIPVFF 449


>sp|P45481|CBP_MOUSE CREB-binding protein OS=Mus musculus GN=Crebbp
PE=1 SV=2
Length = 2441

Score = 33.1 bits (74), Expect = 0.78
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
Frame = -3

Query: 250 SFAGAPRDKFPNDFRRTLFKQCSQ----AKQCRSLDCSNGTCEDNQKTME 113
S G P+ K P + RR ++C Q A QCR+ +CS +C+ ++ ++
Sbjct: 1755 SSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQ 1804


>sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREBBP
PE=1 SV=3
Length = 2442

Score = 33.1 bits (74), Expect = 0.78
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
Frame = -3

Query: 250 SFAGAPRDKFPNDFRRTLFKQCSQ----AKQCRSLDCSNGTCEDNQKTME 113
S G P+ K P + RR ++C Q A QCR+ +CS +C+ ++ ++
Sbjct: 1754 SSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQ 1803


>sp|Q9V730|EXT1_DROME Exostosin-1 OS=Drosophila melanogaster GN=ttv
PE=1 SV=1
Length = 760

Score = 32.0 bits (71), Expect = 1.7
Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 5/66 (7%)
Frame = -3

Query: 199 LFKQCSQAKQCRSLDCSNGTCEDNQKTMEF-----FMDSTFCLQPRGDSFTRRSTFDCLL 35
L C K R L N EDN++ + +STFCL PRG + L
Sbjct: 291 LVTTCRHGKSWRELQ-DNRCDEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQ 349

Query: 34 AGSIPV 17
AG IPV
Sbjct: 350 AGCIPV 355


>sp|Q3J3D0|SURE_RHOS4 5'-nucleotidase surE OS=Rhodobacter
sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM
158) GN=surE PE=3 SV=1
Length = 261

Score = 30.8 bits (68), Expect = 3.9
Identities = 15/48 (31%), Positives = 26/48 (54%)
Frame = -3

Query: 394 ITKLLIERNPWDSKEMGVPYPTNFHPQSDSDLLAWQNHIKGLKRNYLF 251
I +LL+ER WD ++ + Y NF P ++L + +G +R+ F
Sbjct: 152 IVRLLLERGLWDGEDYRLFYNVNFPPVPAANLRGHRVAAQGFRRDTSF 199


>sp|A3PIZ9|SURE_RHOS1 5'-nucleotidase surE OS=Rhodobacter
sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=surE PE=3
SV=1
Length = 261

Score = 30.8 bits (68), Expect = 3.9
Identities = 15/48 (31%), Positives = 26/48 (54%)
Frame = -3

Query: 394 ITKLLIERNPWDSKEMGVPYPTNFHPQSDSDLLAWQNHIKGLKRNYLF 251
I +LL+ER WD ++ + Y NF P ++L + +G +R+ F
Sbjct: 152 IVRLLLERGLWDGEDYRLFYNVNFPPVPAANLRGHRVAAQGFRRDTSF 199


>sp|Q8RFC2|HUTH1_FUSNN Histidine ammonia-lyase 1 OS=Fusobacterium
nucleatum subsp. nucleatum GN=hutH1 PE=3 SV=1
Length = 516

Score = 30.4 bits (67), Expect = 5.0
Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
Frame = -1

Query: 477 LEELHGILGGLKRKIGEVGFSLNQ-QCRTSPSSLLRGTLGIVKRWVCHIQPIFTLKAI 307
+E LHGI+ +IGEV L Q + ++L G+ + K+ V +Q + L+ I
Sbjct: 232 MEGLHGIIDAYDPRIGEVRGHLGQINTAKNMRNILAGSKNVTKQGVERVQDSYVLRCI 289


>sp|Q5K709|CAS1_CRYNE Probable O-acetyltransferase CAS1
OS=Cryptococcus neoformans GN=CAS1 PE=3 SV=1
Length = 960

Score = 30.4 bits (67), Expect = 5.0
Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 11/81 (13%)
Frame = -1

Query: 225 SFRTTLDA-------LCSSNAVK----QSNADPWIVLMEHVRIIRRQWSFLWIPHFACSL 79
SFR TLD LC+ VK Q + PW +M ++ +W F L
Sbjct: 652 SFRVTLDLFIVWVGMLCAYGFVKFNEHQISDRPWFPVMRTATLVGSVLGMIWYFWFELHL 711

Query: 78 VGIVLQGGQHSIVCLLAPFLS 16
+ H++VC++ P +S
Sbjct: 712 ASKFVYNEYHAVVCIV-PIMS 731


>sp|Q8X226|CAS1_CRYNV Probable O-acetyltransferase CAS1
OS=Cryptococcus neoformans var. grubii GN=CAS1 PE=3 SV=1
Length = 959

Score = 30.0 bits (66), Expect = 6.5
Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 11/81 (13%)
Frame = -1

Query: 225 SFRTTLDA-------LCSSNAVK----QSNADPWIVLMEHVRIIRRQWSFLWIPHFACSL 79
SFR TLD LC+ VK Q + PW M +I +W F L
Sbjct: 651 SFRVTLDLFIVWAGMLCAYGFVKFKEYQISDRPWFPTMHTATLIGSVLGMIWYFWFELHL 710

Query: 78 VGIVLQGGQHSIVCLLAPFLS 16
+ H++VC++ P +S
Sbjct: 711 ANKFVYNEYHAVVCIV-PIIS 730


tr_hit_id A7QGV6
Definition tr|A7QGV6|A7QGV6_VITVI Chromosome chr16 scaffold_94, whole genome shotgun sequence OS=Vitis vinifera
Align length 170
Score (bit) 222.0
E-value 9.0e-57
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913849|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_A11.
(510 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QGV6|A7QGV6_VITVI Chromosome chr16 scaffold_94, whole genom... 222 9e-57
tr|Q9LVB4|Q9LVB4_ARATH Gb|AAD21751.1 OS=Arabidopsis thaliana PE=... 219 8e-56
tr|Q5Z9Y2|Q5Z9Y2_ORYSJ Os06g0342000 protein OS=Oryza sativa subs... 202 6e-51
tr|A3BBG1|A3BBG1_ORYSJ Putative uncharacterized protein OS=Oryza... 202 6e-51
tr|A2YCL2|A2YCL2_ORYSI Putative uncharacterized protein OS=Oryza... 202 6e-51
tr|Q7XTY2|Q7XTY2_ORYSJ OSJNBa0019K04.15 protein (Putative unchar... 198 1e-49
tr|Q0JAV7|Q0JAV7_ORYSJ Os04g0574100 protein OS=Oryza sativa subs... 198 1e-49
tr|A2XWM7|A2XWM7_ORYSI Putative uncharacterized protein OS=Oryza... 198 1e-49
tr|A9SI32|A9SI32_PHYPA Predicted protein (Fragment) OS=Physcomit... 189 5e-47
tr|B6SS28|B6SS28_MAIZE Xyloglucan galactosyltransferase KATAMARI... 184 2e-45
tr|A9U4Q5|A9U4Q5_PHYPA Predicted protein (Fragment) OS=Physcomit... 182 8e-45
tr|A9U4Q3|A9U4Q3_PHYPA Predicted protein OS=Physcomitrella paten... 182 8e-45
tr|Q10RV6|Q10RV6_ORYSJ Os03g0144800 protein OS=Oryza sativa subs... 180 3e-44
tr|B8AND4|B8AND4_ORYSI Putative uncharacterized protein OS=Oryza... 180 3e-44
tr|A9SKL8|A9SKL8_PHYPA Predicted protein (Fragment) OS=Physcomit... 180 3e-44
tr|A3AE20|A3AE20_ORYSJ Putative uncharacterized protein OS=Oryza... 180 3e-44
tr|A9RBF2|A9RBF2_PHYPA Predicted protein OS=Physcomitrella paten... 180 4e-44
tr|Q0WWH9|Q0WWH9_ARATH Putative uncharacterized protein At2g2037... 178 1e-43
tr|A7Q1K1|A7Q1K1_VITVI Chromosome chr7 scaffold_44, whole genome... 178 1e-43
tr|Q9FHD8|Q9FHD8_ARATH Gb|AAF19708.1 OS=Arabidopsis thaliana GN=... 177 3e-43
tr|Q9SH31|Q9SH31_ARATH F2K11.17 OS=Arabidopsis thaliana PE=4 SV=1 176 4e-43
tr|O81072|O81072_ARATH Putative uncharacterized protein At2g2904... 173 4e-42
tr|A7QIV5|A7QIV5_VITVI Chromosome chr2 scaffold_105, whole genom... 172 1e-41
tr|Q8L4P3|Q8L4P3_ORYSJ Putative uncharacterized protein OSJNBa00... 170 3e-41
tr|Q337N1|Q337N1_ORYSJ Os10g0459700 protein OS=Oryza sativa subs... 170 3e-41
tr|B8BHB0|B8BHB0_ORYSI Putative uncharacterized protein OS=Oryza... 170 3e-41
tr|B8BHA8|B8BHA8_ORYSI Putative uncharacterized protein OS=Oryza... 170 3e-41
tr|A3C5G6|A3C5G6_ORYSJ Putative uncharacterized protein OS=Oryza... 170 3e-41
tr|Q8LMZ1|Q8LMZ1_ORYSJ Os10g0459600 protein OS=Oryza sativa subs... 169 9e-41
tr|A3C5G5|A3C5G5_ORYSJ Putative uncharacterized protein OS=Oryza... 169 9e-41

>tr|A7QGV6|A7QGV6_VITVI Chromosome chr16 scaffold_94, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038506001
PE=4 SV=1
Length = 432

Score = 222 bits (565), Expect = 9e-57
Identities = 101/170 (59%), Positives = 125/170 (73%), Gaps = 2/170 (1%)
Frame = -3

Query: 505 SGGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
S G DHF+ +GRITWDFRR K+EDWGS P M+NIT+LLIERNPWD ++GVPYPT
Sbjct: 169 SNGWDHFITLGRITWDFRRSKDEDWGSSLIYMPLMRNITRLLIERNPWDYFDVGVPYPTG 228

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQC-SQAKQCRSLDCS 149
FHP+SD+D+L WQ+H++ R LFSFAGA R NDFR L + C +++ CR +DC+
Sbjct: 229 FHPRSDADVLQWQHHVRTRNRTTLFSFAGATRGAIRNDFRGLLLRHCLNESDSCRVVDCA 288

Query: 148 NGTCEDNQKT-MEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFFWHR 2
C + +E F+DS FCLQPRGDSFTRRS FDC++AGSIPVFFW R
Sbjct: 289 GTRCSNGTSAILESFLDSDFCLQPRGDSFTRRSIFDCMIAGSIPVFFWRR 338


>tr|Q9LVB4|Q9LVB4_ARATH Gb|AAD21751.1 OS=Arabidopsis thaliana PE=4
SV=1
Length = 549

Score = 219 bits (557), Expect = 8e-56
Identities = 100/170 (58%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
Frame = -3

Query: 505 SGGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
S G DHF+ +GRITWDFRR K+EDWGS P M+NIT+LLIERN WD ++GVPYPT
Sbjct: 252 SNGWDHFITMGRITWDFRRSKDEDWGSNCIYIPGMRNITRLLIERNSWDHFDVGVPYPTG 311

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQAK-QCRSLDCS 149
FHP+SDSD++ WQ+ ++ +R LF FAGAPR NDFR L + C +++ +CR++DC+
Sbjct: 312 FHPRSDSDVVNWQDFVRNRRRETLFCFAGAPRAGIVNDFRGLLLRHCEESRGKCRTVDCT 371

Query: 148 NGTCEDNQKT-MEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFFWHR 2
G C + +E F+ S FCLQPRGDSFTRRS FDC+LAGSIPVFFW R
Sbjct: 372 VGKCSNGSSAILETFLGSDFCLQPRGDSFTRRSIFDCMLAGSIPVFFWRR 421


>tr|Q5Z9Y2|Q5Z9Y2_ORYSJ Os06g0342000 protein OS=Oryza sativa subsp.
japonica GN=P0459H02.11 PE=2 SV=1
Length = 556

Score = 202 bits (515), Expect = 6e-51
Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 3/171 (1%)
Frame = -3

Query: 505 SGGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
SGG DHF+ +GRITWDFRR+ + WG+ P M+N+T+L+IE + D ++GVPYPT
Sbjct: 219 SGGWDHFITLGRITWDFRRYGADGWGTNLVLMPGMENVTRLVIEGDRLDPLDVGVPYPTG 278

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQA--KQCRSLDC 152
FHP+ +D+ AWQ H+ L R LF FAGAPR FP+DFR L ++C A +CR++DC
Sbjct: 279 FHPRRAADVRAWQEHVLSLDRRNLFGFAGAPRSGFPDDFRDVLLEECEDAGSDRCRAVDC 338

Query: 151 SNGTC-EDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFFWHR 2
C +D M FM S FCLQPRGDSFTRRS FDC++AG++PV FW R
Sbjct: 339 RGTRCNDDGAAVMRLFMGSRFCLQPRGDSFTRRSLFDCMVAGAVPVLFWRR 389


>tr|A3BBG1|A3BBG1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_020383 PE=4 SV=1
Length = 555

Score = 202 bits (515), Expect = 6e-51
Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 3/171 (1%)
Frame = -3

Query: 505 SGGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
SGG DHF+ +GRITWDFRR+ + WG+ P M+N+T+L+IE + D ++GVPYPT
Sbjct: 219 SGGWDHFITLGRITWDFRRYGADGWGTNLVLMPGMENVTRLVIEGDRLDPLDVGVPYPTG 278

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQA--KQCRSLDC 152
FHP+ +D+ AWQ H+ L R LF FAGAPR FP+DFR L ++C A +CR++DC
Sbjct: 279 FHPRRAADVRAWQEHVLSLDRRNLFGFAGAPRSGFPDDFRDVLLEECEDAGSDRCRAVDC 338

Query: 151 SNGTC-EDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFFWHR 2
C +D M FM S FCLQPRGDSFTRRS FDC++AG++PV FW R
Sbjct: 339 RGTRCNDDGAAVMRLFMGSRFCLQPRGDSFTRRSLFDCMVAGAVPVLFWRR 389


>tr|A2YCL2|A2YCL2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_22853 PE=4 SV=1
Length = 555

Score = 202 bits (515), Expect = 6e-51
Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 3/171 (1%)
Frame = -3

Query: 505 SGGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
SGG DHF+ +GRITWDFRR+ + WG+ P M+N+T+L+IE + D ++GVPYPT
Sbjct: 219 SGGWDHFITLGRITWDFRRYGADGWGTNLVLMPGMENVTRLVIEGDRLDPLDVGVPYPTG 278

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQA--KQCRSLDC 152
FHP+ +D+ AWQ H+ L R LF FAGAPR FP+DFR L ++C A +CR++DC
Sbjct: 279 FHPRRAADVRAWQEHVLSLDRRNLFGFAGAPRSGFPDDFRDVLLEECEDAGSDRCRAVDC 338

Query: 151 SNGTC-EDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFFWHR 2
C +D M FM S FCLQPRGDSFTRRS FDC++AG++PV FW R
Sbjct: 339 RGTRCNDDGAAVMRLFMGSRFCLQPRGDSFTRRSLFDCMVAGAVPVLFWRR 389


>tr|Q7XTY2|Q7XTY2_ORYSJ OSJNBa0019K04.15 protein (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=OSJNBa0019K04.15 PE=4 SV=1
Length = 471

Score = 198 bits (504), Expect = 1e-49
Identities = 87/170 (51%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
Frame = -3

Query: 505 SGGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
S G DHF+ +GRITWDFRR + WG F P + N T+L+IER+PWD+ ++G+PYPT+
Sbjct: 201 SNGWDHFIALGRITWDFRRSPDGGWGGSFLLMPGLANTTRLVIERDPWDAMDVGIPYPTS 260

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQA-KQCRSLDCS 149
FHP++ +D+ AWQ + R LF+FAGAPR DFR L ++C A C +LDC
Sbjct: 261 FHPRTAADVRAWQQYASSRSRPKLFAFAGAPRSAIKGDFRGLLLEECQAAGDACGALDCG 320

Query: 148 NGTC-EDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFFWHR 2
G C + N+ ME F+ + FCLQPRGDSFTRRS FDC++ G++PV FW R
Sbjct: 321 EGRCIKQNELVMELFLGARFCLQPRGDSFTRRSLFDCMVGGAVPVLFWRR 370


>tr|Q0JAV7|Q0JAV7_ORYSJ Os04g0574100 protein OS=Oryza sativa subsp.
japonica GN=Os04g0574100 PE=2 SV=1
Length = 474

Score = 198 bits (504), Expect = 1e-49
Identities = 87/170 (51%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
Frame = -3

Query: 505 SGGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
S G DHF+ +GRITWDFRR + WG F P + N T+L+IER+PWD+ ++G+PYPT+
Sbjct: 204 SNGWDHFIALGRITWDFRRSPDGGWGGSFLLMPGLANTTRLVIERDPWDAMDVGIPYPTS 263

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQA-KQCRSLDCS 149
FHP++ +D+ AWQ + R LF+FAGAPR DFR L ++C A C +LDC
Sbjct: 264 FHPRTAADVRAWQQYASSRSRPKLFAFAGAPRSAIKGDFRGLLLEECQAAGDACGALDCG 323

Query: 148 NGTC-EDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFFWHR 2
G C + N+ ME F+ + FCLQPRGDSFTRRS FDC++ G++PV FW R
Sbjct: 324 EGRCIKQNELVMELFLGARFCLQPRGDSFTRRSLFDCMVGGAVPVLFWRR 373


>tr|A2XWM7|A2XWM7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17054 PE=4 SV=1
Length = 471

Score = 198 bits (504), Expect = 1e-49
Identities = 87/170 (51%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
Frame = -3

Query: 505 SGGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTN 326
S G DHF+ +GRITWDFRR + WG F P + N T+L+IER+PWD+ ++G+PYPT+
Sbjct: 201 SNGWDHFIALGRITWDFRRSPDGGWGGSFLLMPGLANTTRLVIERDPWDAMDVGIPYPTS 260

Query: 325 FHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQA-KQCRSLDCS 149
FHP++ +D+ AWQ + R LF+FAGAPR DFR L ++C A C +LDC
Sbjct: 261 FHPRTAADVRAWQRYASSRSRPKLFAFAGAPRSAIKGDFRGLLLEECQAAGDACGALDCG 320

Query: 148 NGTC-EDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFFWHR 2
G C + N+ ME F+ + FCLQPRGDSFTRRS FDC++ G++PV FW R
Sbjct: 321 EGRCIKQNELVMELFLGARFCLQPRGDSFTRRSLFDCMVGGAVPVLFWRR 370


>tr|A9SI32|A9SI32_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_13053 PE=4 SV=1
Length = 378

Score = 189 bits (481), Expect = 5e-47
Identities = 85/164 (51%), Positives = 110/164 (67%)
Frame = -3

Query: 502 GGVDHFMMVGRITWDFRRFKEEDWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPTNF 323
GG+DHFM+ GRITWDFRR + WG+ T P MQN+T L+IE + W++ +MG+PYPT F
Sbjct: 131 GGIDHFMVGGRITWDFRR-QGNSWGNKLLTLPPMQNMTTLVIEASTWNTNDMGIPYPTYF 189

Query: 322 HPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQAKQCRSLDCSNG 143
HP DS++ AWQ ++ +RN LFSFAG RD R + QC ++ C+ L C G
Sbjct: 190 HPSCDSEIRAWQQKVRSFQRNVLFSFAGGKRDNMARLIRGQVIDQCGRSPLCKLLSCDRG 249

Query: 142 TCEDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFF 11
C+ Q M+ F +S FCLQP+GDS TRRS FD +LAG IPVFF
Sbjct: 250 ACQSPQPVMKLFKESQFCLQPQGDSATRRSIFDSMLAGCIPVFF 293


>tr|B6SS28|B6SS28_MAIZE Xyloglucan galactosyltransferase KATAMARI 1
OS=Zea mays PE=2 SV=1
Length = 603

Score = 184 bits (467), Expect = 2e-45
Identities = 84/168 (50%), Positives = 111/168 (66%), Gaps = 4/168 (2%)
Frame = -3

Query: 502 GGVDHFMMVGRITWDFRRFKEE--DWGSGFFTKPAMQNITKLLIERNPWDSKEMGVPYPT 329
GG DHF++ GRITWDFRR EE DWGS PA +N++ L++E +PW+S + G+PYPT
Sbjct: 274 GGRDHFLVAGRITWDFRRLTEEEADWGSKLLFLPAAKNMSMLVVESSPWNSNDFGIPYPT 333

Query: 328 NFHPQSDSDLLAWQNHIKGLKRNYLFSFAGAPRDKFPNDFRRTLFKQCSQAKQCRSLDCS 149
FHP D+++ WQ+ ++ L+R +LFSFAGAPR P R L QC + C+ L+C
Sbjct: 334 YFHPAKDAEVFLWQDRMRSLERPWLFSFAGAPRPGDPMSIRGQLIDQCRSSSLCKLLECD 393

Query: 148 NG--TCEDNQKTMEFFMDSTFCLQPRGDSFTRRSTFDCLLAGSIPVFF 11
G C M+ F S FCLQP+GDS+TRRS FD +LAG +PVFF
Sbjct: 394 LGESKCHSPSTIMKMFQSSMFCLQPQGDSYTRRSAFDSMLAGCVPVFF 441