BP913863
Clone id YMU001_000037_C01
Library
Length 416
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTAGCAGCTGATTAAGCACTCTTTCTGCAACAGCATTTCCATCTGTGCCACGTCTTGGA
GCAAGAGCATCCAGTTCATCAAAGAAAATAATGCATGGTGAGCAGGAGCGTGCGCGAGCA
AACAAGGCACGAACAGAATGTTCGCTTTCCCCAACATATTTGTTCAGAAGCTCCGGACCC
TTAACATAGATAAAATTGGCTTGTGCATCATTAGCTACAGCCTTTGCCACGAGAGTTTTT
TCACAACCAGGAGGTCCATACAGAAGAAACCCAGTGTCCATGTCCAAACCGAGCATCTCA
TAATCCTCAGGATGTTTGATACGCCTTGAGATGAAGAATTCCAGGCACTTTTGCAGAGAT
CCAAGAGCCCCCACATCCTCCCATTTCACGTTTGGTATAGCAGAAAATCCTTCACG
■■Homology search results ■■ -
sp_hit_id Q9SS94
Definition sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana
Align length 138
Score (bit) 182.0
E-value 6.0e-46
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913863|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_C01.
(416 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C... 182 6e-46
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=D... 176 4e-44
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing prote... 167 2e-41
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharo... 164 1e-40
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=H... 157 2e-38
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=M... 156 3e-38
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=... 154 1e-37
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E... 154 1e-37
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D... 154 2e-37
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A... 153 2e-37
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=... 150 1e-36
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mu... 150 2e-36
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Ho... 150 2e-36
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1... 149 6e-36
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_... 148 9e-36
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase T... 147 2e-35
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase O... 146 3e-35
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=... 146 3e-35
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=... 146 3e-35
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase O... 146 3e-35
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase O... 146 3e-35
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase O... 146 3e-35
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase ... 145 5e-35
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase ... 145 8e-35
sp|Q9HPF0|CDCH_HALSA Protein cdcH OS=Halobacterium salinarium GN... 143 3e-34
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum ... 142 7e-34
sp|Q6FW67|PEX6_CANGA Peroxisomal biogenesis factor 6 OS=Candida ... 140 2e-33
sp|P33289|PEX6_PICPA Peroxisomal biogenesis factor 6 OS=Pichia p... 140 3e-33
sp|Q6BS73|PEX6_DEBHA Peroxisomal biogenesis factor 6 OS=Debaryom... 139 6e-33
sp|Q7SGP2|PEX6_NEUCR Peroxisomal biogenesis factor 6 OS=Neurospo... 138 8e-33

>sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C
OS=Arabidopsis thaliana GN=CDC48C PE=1 SV=2
Length = 820

Score = 182 bits (461), Expect = 6e-46
Identities = 85/138 (61%), Positives = 108/138 (78%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGFS +P+VKW+DVG L L+ +I R IK P+ Y+ G+D++TGFLLYGPPGC K
Sbjct: 516 REGFSIVPDVKWDDVGGLDHLRLQFNRYIVRPIKKPDIYKAFGVDLETGFLLYGPPGCGK 575

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKA AN+A ANF+++KG ELLNKYVGESE ++R LF RAR+C+PC+IFFDE+DAL
Sbjct: 576 TLIAKAAANEAGANFMHIKGAELLNKYVGESELAIRTLFQRARTCAPCVIFFDEVDALTT 635

Query: 56 RRGTDGNAVAERVLNQLL 3
RG +G V ER+LNQ L
Sbjct: 636 SRGKEGAWVVERLLNQFL 653



Score = 90.5 bits (223), Expect = 2e-18
Identities = 43/127 (33%), Positives = 75/127 (59%)
Frame = -1

Query: 383 WEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVANDA 204
++D G + + LE + I +PE ++ +G+ +G L +GPPGC KT +A A+AN+A
Sbjct: 232 FKDFGGIKKILDELEMNVLFPILNPEPFKKIGVKPPSGILFHGPPGCGKTKLANAIANEA 291

Query: 203 QANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGNAVAE 24
F + E+++ G SE ++R LF++A +P I+F DE+DA+ +R + +
Sbjct: 292 GVPFYKISATEVISGVSGASEENIRELFSKAYRTAPSIVFIDEIDAIGSKRENQQREMEK 351

Query: 23 RVLNQLL 3
R++ QLL
Sbjct: 352 RIVTQLL 358


>sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl
OS=Dictyostelium discoideum GN=nvl PE=3 SV=1
Length = 867

Score = 176 bits (445), Expect = 4e-44
Identities = 86/141 (60%), Positives = 108/141 (76%), Gaps = 3/141 (2%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ IPNV W+DVGAL +++ L I R I++P+ Y+ +G+D G L+YGPPGC K
Sbjct: 554 REGFATIPNVTWDDVGALSGVREELTNSILRPIRYPKKYKNMGIDSPAGVLMYGPPGCGK 613

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKA+A++ QANFI VKGPELLNKYVGESE +VR +F RA + SPC+IFFDE DALAP
Sbjct: 614 TLLAKAIASECQANFISVKGPELLNKYVGESERAVRQVFQRAAASSPCVIFFDEFDALAP 673

Query: 56 RRG---TDGNAVAERVLNQLL 3
+RG GN ERV+NQLL
Sbjct: 674 KRGGGDGGGNQATERVVNQLL 694



Score = 103 bits (258), Expect = 2e-22
Identities = 52/132 (39%), Positives = 80/132 (60%)
Frame = -1

Query: 398 IPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKA 219
IP + + ++G + S + + I I HPE Y LG++ G LL+GP GC KTL+AKA
Sbjct: 210 IPTINFSNLGGVESCLRDIREHIEYPICHPEIYSHLGVEPPRGILLHGPSGCGKTLLAKA 269

Query: 218 VANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDG 39
+A + + + E+ + GESE VR LF+ A + +PCIIF DE+DA+AP+R +
Sbjct: 270 IAGELKVPLFAISATEITSGVSGESEARVRTLFSNAIAQAPCIIFIDEIDAIAPKRESAS 329

Query: 38 NAVAERVLNQLL 3
+ R+++QLL
Sbjct: 330 KDMERRIVSQLL 341


>sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein
C16E9.10c OS=Schizosaccharomyces pombe GN=SPBC16E9.10c
PE=1 SV=1
Length = 779

Score = 167 bits (422), Expect = 2e-41
Identities = 79/138 (57%), Positives = 105/138 (76%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ +P V W ++GAL S++ L+ I + IK PE Y+ +G+ TG LL+GPPGC K
Sbjct: 480 REGFATVPGVSWNNIGALKSIRVELQMAIVQPIKRPELYQSVGISAPTGVLLWGPPGCGK 539

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKAVAN+++ANFI ++GPELLNKYVGESE +VR +F RAR+ SPC+IFFDELDA+ P
Sbjct: 540 TLLAKAVANESKANFISIRGPELLNKYVGESERAVRQVFLRARASSPCVIFFDELDAMVP 599

Query: 56 RRGTDGNAVAERVLNQLL 3
RR + + RV+N LL
Sbjct: 600 RRDDSLSEASSRVVNTLL 617



Score = 103 bits (257), Expect = 3e-22
Identities = 49/130 (37%), Positives = 77/130 (59%)
Frame = -1

Query: 392 NVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVA 213
++ D+G L L ++ IKHPE Y+ G+ G LL+GPPGC KT++A A+A
Sbjct: 170 DISLSDIGGLDDCINELLELVAMPIKHPEVYQYTGIHPPRGVLLHGPPGCGKTMLANALA 229

Query: 212 NDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGNA 33
N+ FI + P +++ GESE VR +F A+S +PC++F DE+DA+ P+R +
Sbjct: 230 NELGVPFISISAPSIVSGMSGESEKKVREVFEEAKSLAPCLMFIDEIDAVTPKRESAQRE 289

Query: 32 VAERVLNQLL 3
+ R++ Q L
Sbjct: 290 MERRIVAQFL 299


>sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7
OS=Saccharomyces cerevisiae GN=RIX7 PE=1 SV=1
Length = 837

Score = 164 bits (416), Expect = 1e-40
Identities = 81/138 (58%), Positives = 103/138 (74%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ +P+V W +VGAL ++ L I + IK PE YE +G+ G LL+GPPGC K
Sbjct: 521 REGFATVPDVTWANVGALQRVRLELNMAIVQPIKRPELYEKVGISAPGGVLLWGPPGCGK 580

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKAVAN+++ANFI +KGPELLNKYVGESE S+R +F RAR+ PC+IFFDELDAL P
Sbjct: 581 TLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARASVPCVIFFDELDALVP 640

Query: 56 RRGTDGNAVAERVLNQLL 3
RR T + + RV+N LL
Sbjct: 641 RRDTSLSESSSRVVNTLL 658



Score = 102 bits (255), Expect = 5e-22
Identities = 55/134 (41%), Positives = 79/134 (58%), Gaps = 3/134 (2%)
Frame = -1

Query: 395 PNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAV 216
PN + +G + + L I I HPE + G++ G LL+GPPGC KT +A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 215 ANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGN 36
A + Q FI + P +++ GESE +R LF ARS +PC++FFDE+DA+ P+R DG
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKR--DGG 317

Query: 35 AVAE---RVLNQLL 3
A E R++ QLL
Sbjct: 318 AQREMERRIVAQLL 331


>sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo
sapiens GN=NVL PE=1 SV=1
Length = 856

Score = 157 bits (396), Expect = 2e-38
Identities = 76/138 (55%), Positives = 99/138 (71%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF +PNV W D+GAL +++ L I +++P+ ++ LGL G LL GPPGC K
Sbjct: 569 REGFVTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGK 628

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKAVAN++ NFI VKGPELLN YVGESE +VR +F RA++ +PC+IFFDE+DAL P
Sbjct: 629 TLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCP 688

Query: 56 RRGTDGNAVAERVLNQLL 3
RR + RV+NQLL
Sbjct: 689 RRSDRETGASVRVVNQLL 706



Score = 104 bits (260), Expect = 1e-22
Identities = 58/133 (43%), Positives = 81/133 (60%), Gaps = 1/133 (0%)
Frame = -1

Query: 398 IPNVKWEDVGALG-SLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAK 222
I NVK+EDVG +L++ + I R HPE Y LG+ G LL+GPPGC KTL+A
Sbjct: 259 ISNVKFEDVGGNDMTLKEVCKMLIHMR--HPEVYHHLGVVPPRGVLLHGPPGCGKTLLAH 316

Query: 221 AVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTD 42
A+A + + V PE+++ GESE +R LF +A S +PCIIF DE+DA+ P+R
Sbjct: 317 AIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVA 376

Query: 41 GNAVAERVLNQLL 3
+ R++ QLL
Sbjct: 377 SKDMERRIVAQLL 389


>sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus
musculus GN=Nvl PE=2 SV=1
Length = 855

Score = 156 bits (394), Expect = 3e-38
Identities = 76/138 (55%), Positives = 97/138 (70%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF +PNV W D+GAL ++ L I +++P+ + LGL G LL GPPGC K
Sbjct: 568 REGFVTVPNVTWADIGALEDIRDELIMAILAPVRNPDQFRTLGLGTPAGILLAGPPGCGK 627

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKAVAN++ NFI VKGPELLN YVGESE +VR +F RA++ +PC+IFFDE+DAL P
Sbjct: 628 TLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCP 687

Query: 56 RRGTDGNAVAERVLNQLL 3
RR + RV+NQLL
Sbjct: 688 RRSDRETGASVRVVNQLL 705



Score = 105 bits (261), Expect = 9e-23
Identities = 57/133 (42%), Positives = 82/133 (61%), Gaps = 1/133 (0%)
Frame = -1

Query: 398 IPNVKWEDVGAL-GSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAK 222
I NVK+EDVG +L++ + I R HPE Y+ LG+ G LL+GPPGC KTL+A
Sbjct: 258 ISNVKFEDVGGNDATLKEVCKMLIHMR--HPEVYQHLGVVPPRGVLLHGPPGCGKTLLAH 315

Query: 221 AVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTD 42
A+A + + V PE+++ GESE +R LF +A S +PCI+F DE+DA+ P+R
Sbjct: 316 AIAGELDLPILKVAAPEIVSGVSGESEQKLRELFDQAVSNAPCIVFIDEIDAITPKREVA 375

Query: 41 GNAVAERVLNQLL 3
+ R++ QLL
Sbjct: 376 SKDMERRIVAQLL 388


>sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog
OS=Glycine max GN=CDC48 PE=2 SV=1
Length = 807

Score = 154 bits (390), Expect = 1e-37
Identities = 73/141 (51%), Positives = 100/141 (70%), Gaps = 3/141 (2%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
RE +PNV WED+G L ++++ L+ + ++HPE +E G+ G L YGPPGC K
Sbjct: 469 RETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGK 528

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKA+AN+ QANFI VKGPELL + GESE +VR +F +AR +PC++FFDELD++A
Sbjct: 529 TLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIAT 588

Query: 56 RRGT---DGNAVAERVLNQLL 3
+RG+ D A+RVLNQLL
Sbjct: 589 QRGSSVGDAGGAADRVLNQLL 609



Score = 109 bits (273), Expect = 4e-24
Identities = 53/138 (38%), Positives = 83/138 (60%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
RE + V ++DVG + + + ++HP+ ++ +G+ G LLYGPPG K
Sbjct: 196 REDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGK 255

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+A+AVAN+ A F + GPE+++K GESE ++R F A +P IIF DE+D++AP
Sbjct: 256 TLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAP 315

Query: 56 RRGTDGNAVAERVLNQLL 3
+R V R+++QLL
Sbjct: 316 KREKTHGEVERRIVSQLL 333


>sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E
OS=Arabidopsis thaliana GN=CDC48E PE=2 SV=2
Length = 810

Score = 154 bits (389), Expect = 1e-37
Identities = 73/141 (51%), Positives = 99/141 (70%), Gaps = 3/141 (2%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
RE +PNV WED+G L ++++ L+ + ++HPE +E G+ G L YGPPGC K
Sbjct: 468 RETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGK 527

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKA+AN+ QANFI VKGPELL + GESE +VR +F +AR +PC++FFDELD++A
Sbjct: 528 TLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIAT 587

Query: 56 RRGT---DGNAVAERVLNQLL 3
+RG D A+RVLNQLL
Sbjct: 588 QRGNSAGDAGGAADRVLNQLL 608



Score = 110 bits (275), Expect = 2e-24
Identities = 53/138 (38%), Positives = 83/138 (60%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
RE + V ++DVG + + + ++HP+ ++ +G+ G LLYGPPG K
Sbjct: 195 REDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGK 254

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+A+AVAN+ A F + GPE+++K GESE ++R F A +P IIF DE+D++AP
Sbjct: 255 TLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAP 314

Query: 56 RRGTDGNAVAERVLNQLL 3
+R V R+++QLL
Sbjct: 315 KREKTNGEVERRIVSQLL 332


>sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D
OS=Arabidopsis thaliana GN=CDC48D PE=2 SV=1
Length = 815

Score = 154 bits (388), Expect = 2e-37
Identities = 72/141 (51%), Positives = 99/141 (70%), Gaps = 3/141 (2%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
RE +PNV WED+G L ++++ L+ + ++HPE +E G+ G L YGPPGC K
Sbjct: 469 RETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGK 528

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKA+AN+ QANFI +KGPELL + GESE +VR +F +AR +PC++FFDELD++A
Sbjct: 529 TLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIAT 588

Query: 56 RRGT---DGNAVAERVLNQLL 3
+RG D A+RVLNQLL
Sbjct: 589 QRGNSVGDAGGAADRVLNQLL 609



Score = 109 bits (273), Expect = 4e-24
Identities = 53/138 (38%), Positives = 83/138 (60%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
RE + V ++DVG + + + ++HP+ ++ +G+ G LLYGPPG K
Sbjct: 196 REDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGK 255

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+A+AVAN+ A F + GPE+++K GESE ++R F A +P IIF DE+D++AP
Sbjct: 256 TLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAP 315

Query: 56 RRGTDGNAVAERVLNQLL 3
+R V R+++QLL
Sbjct: 316 KREKTHGEVERRIVSQLL 333


>sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A
OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1
Length = 809

Score = 153 bits (387), Expect = 2e-37
Identities = 73/142 (51%), Positives = 99/142 (69%), Gaps = 4/142 (2%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
RE +PNV W D+G L ++++ L+ + ++HPE +E G+ G L YGPPGC K
Sbjct: 468 RETVVEVPNVSWNDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGK 527

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKA+AN+ QANFI VKGPELL + GESE +VR +F +AR +PC++FFDELD++A
Sbjct: 528 TLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIAT 587

Query: 56 RR----GTDGNAVAERVLNQLL 3
+R G DG A+RVLNQLL
Sbjct: 588 QRGGGSGGDGGGAADRVLNQLL 609



Score = 110 bits (276), Expect = 2e-24
Identities = 53/138 (38%), Positives = 84/138 (60%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
RE + +V ++DVG + + + ++HP+ ++ +G+ G LLYGPPG K
Sbjct: 195 REDEERLDDVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGK 254

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+A+AVAN+ A F + GPE+++K GESE ++R F A +P IIF DE+D++AP
Sbjct: 255 TLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAP 314

Query: 56 RRGTDGNAVAERVLNQLL 3
+R V R+++QLL
Sbjct: 315 KREKTNGEVERRIVSQLL 332


tr_hit_id A7QBR7
Definition tr|A7QBR7|A7QBR7_VITVI Chromosome chr1 scaffold_75, whole genome shotgun sequence OS=Vitis vinifera
Align length 138
Score (bit) 206.0
E-value 4.0e-52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913863|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_C01.
(416 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QBR7|A7QBR7_VITVI Chromosome chr1 scaffold_75, whole genome... 206 4e-52
tr|A9RNZ5|A9RNZ5_PHYPA Predicted protein OS=Physcomitrella paten... 203 4e-51
tr|A8J040|A8J040_CHLRE Predicted protein (Fragment) OS=Chlamydom... 192 9e-48
tr|A4S9B4|A4S9B4_OSTLU Predicted protein OS=Ostreococcus lucimar... 189 5e-47
tr|Q00T93|Q00T93_OSTTA 26S proteasome regulatory complex, ATPase... 189 6e-47
tr|Q5VRN1|Q5VRN1_ORYSJ Os06g0109400 protein OS=Oryza sativa subs... 185 9e-46
tr|B8B1J7|B8B1J7_ORYSI Putative uncharacterized protein OS=Oryza... 185 9e-46
tr|A3B7M8|A3B7M8_ORYSJ Putative uncharacterized protein OS=Oryza... 185 9e-46
tr|B8CDA1|B8CDA1_THAPS Nuclear vcp-like-like protein (Fragment) ... 181 1e-44
tr|B6A9M1|B6A9M1_9CRYT ATPase, AAA family protein OS=Cryptospori... 180 3e-44
tr|B7G4E0|B7G4E0_PHATR Predicted protein (Fragment) OS=Phaeodact... 174 2e-42
tr|Q4FYL6|Q4FYL6_LEIMA Vesicular transport protein (CDC48 homolo... 174 2e-42
tr|A4I2Q7|A4I2Q7_LEIIN Vesicular transport protein (CDC48 homolo... 174 2e-42
tr|A4HFM9|A4HFM9_LEIBR Vesicular transport protein (CDC48 homolo... 174 2e-42
tr|Q386Y8|Q386Y8_9TRYP Vesicular transport protein (CDC48 homolo... 173 3e-42
tr|Q5KNC4|Q5KNC4_CRYNE Helicase, putative (Putative uncharacteri... 172 6e-42
tr|Q4DQD6|Q4DQD6_TRYCR Vesicular transport protein (CDC48 homolo... 172 7e-42
tr|B7PKZ5|B7PKZ5_IXOSC Putative uncharacterized protein OS=Ixode... 172 1e-41
tr|A4R2C4|A4R2C4_MAGGR Putative uncharacterized protein OS=Magna... 169 6e-41
tr|Q5CRP4|Q5CRP4_CRYPV Nuclear VCP like protein with 2 AAA ATpas... 168 1e-40
tr|Q5CMY1|Q5CMY1_CRYHO AAA ATPase OS=Cryptosporidium hominis GN=... 168 1e-40
tr|Q2UPJ9|Q2UPJ9_ASPOR Nuclear AAA ATPase OS=Aspergillus oryzae ... 168 1e-40
tr|B8MWF7|B8MWF7_ASPFL AAA family ATPase/60S ribosome export pro... 168 1e-40
tr|A8Q117|A8Q117_MALGO Putative uncharacterized protein OS=Malas... 167 3e-40
tr|A1D3F4|A1D3F4_NEOFI AAA family ATPase/60S ribosome export pro... 167 3e-40
tr|Q4PF17|Q4PF17_USTMA Putative uncharacterized protein OS=Ustil... 166 4e-40
tr|B2B1B2|B2B1B2_PODAN Predicted CDS Pa_3_8790 OS=Podospora anse... 166 4e-40
tr|Q753Y4|Q753Y4_ASHGO AFR188Wp OS=Ashbya gossypii GN=AFR188W PE... 166 5e-40
tr|Q5BDL4|Q5BDL4_EMENI Putative uncharacterized protein OS=Emeri... 166 5e-40
tr|Q1DRB7|Q1DRB7_COCIM Putative uncharacterized protein OS=Cocci... 166 5e-40

>tr|A7QBR7|A7QBR7_VITVI Chromosome chr1 scaffold_75, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035083001
PE=3 SV=1
Length = 659

Score = 206 bits (525), Expect = 4e-52
Identities = 97/138 (70%), Positives = 118/138 (85%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGFS IPNV+WEDVG L L++ + +I RRIK+PEDYE G+D++TGFLLYGPPGC K
Sbjct: 376 REGFSTIPNVRWEDVGGLDFLRQEFDRYIVRRIKYPEDYEEFGVDLETGFLLYGPPGCGK 435

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKAVAN+A ANFI++KGPELLNKYVGESE +VR LF+RAR+CSPCI+FFDE+DAL
Sbjct: 436 TLIAKAVANEAGANFIHIKGPELLNKYVGESELAVRTLFSRARTCSPCILFFDEVDALTT 495

Query: 56 RRGTDGNAVAERVLNQLL 3
+RG +G V ER+LNQLL
Sbjct: 496 KRGKEGGWVVERLLNQLL 513



Score = 86.7 bits (213), Expect = 5e-16
Identities = 43/127 (33%), Positives = 75/127 (59%)
Frame = -1

Query: 383 WEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVANDA 204
+ D+G + S+ + L+ + + +PE LG+ G LL+GPPGC KT +A A+AN+
Sbjct: 82 FSDLGGMKSVVEDLKMEVIVPLYYPELPRWLGVRPMAGILLHGPPGCGKTKLAHAIANET 141

Query: 203 QANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGNAVAE 24
+ F + E+++ G SE ++R LF++A +P I+F DE+DA+A +R +
Sbjct: 142 KVPFYKISATEVVSGVSGASEENIRELFSKAYRTAPSIVFIDEIDAIASKRENLNREMER 201

Query: 23 RVLNQLL 3
R++ QL+
Sbjct: 202 RIVTQLM 208


>tr|A9RNZ5|A9RNZ5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_117191 PE=3 SV=1
Length = 632

Score = 203 bits (516), Expect = 4e-51
Identities = 96/138 (69%), Positives = 117/138 (84%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ IP+V W+DVG+L +++ LEF I R IK PE+Y+ LG++M TG LLYGPPGC K
Sbjct: 336 REGFATIPDVTWDDVGSLCDVREDLEFSICRAIKFPEEYQALGMEMATGVLLYGPPGCGK 395

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TLVAKA+AN+A ANFI VKGPELLNKYVGESE ++R LF RAR+ SPCI+FFDE+DA+AP
Sbjct: 396 TLVAKAIANEAGANFISVKGPELLNKYVGESERAIRQLFTRARASSPCILFFDEMDAMAP 455

Query: 56 RRGTDGNAVAERVLNQLL 3
RRG+DGN AERV+NQLL
Sbjct: 456 RRGSDGNGAAERVVNQLL 473



Score = 109 bits (272), Expect = 8e-23
Identities = 54/135 (40%), Positives = 84/135 (62%), Gaps = 1/135 (0%)
Frame = -1

Query: 404 SAIP-NVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLV 228
+A+P NV +++ G + + + I + + HPE YE LG+ G LL+GPPGC KT++
Sbjct: 42 AAVPRNVSFKNFGGIEGILGDIRDIIEQPLAHPELYEWLGVQPPRGVLLHGPPGCGKTML 101

Query: 227 AKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRG 48
A A+A + F+ + PE+++ GESE VR+LFA A +PCI+F DE+DA+ P+R
Sbjct: 102 ANAIAVETGVPFLKISAPEVVSGMSGESEAKVRSLFAEAVKLAPCIVFIDEIDAITPKRE 161

Query: 47 TDGNAVAERVLNQLL 3
T + R++ QLL
Sbjct: 162 TAQREMERRIVAQLL 176


>tr|A8J040|A8J040_CHLRE Predicted protein (Fragment)
OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_38371 PE=3
SV=1
Length = 580

Score = 192 bits (487), Expect = 9e-48
Identities = 93/138 (67%), Positives = 111/138 (80%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ P+V W+DVGAL +++ L F ++ IK PE +E LGL +G LLYGPPGC K
Sbjct: 301 REGFTTTPDVTWDDVGALAEVREELSFAVTEPIKWPERFEALGLPAASGVLLYGPPGCGK 360

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TLVAKAVAN++ ANFI +KGPELLNKYVGESE +VR LFARAR+ PC++FFDELDALAP
Sbjct: 361 TLVAKAVANESGANFISIKGPELLNKYVGESERAVRQLFARARAAHPCVLFFDELDALAP 420

Query: 56 RRGTDGNAVAERVLNQLL 3
RRGTD N AERV+NQLL
Sbjct: 421 RRGTDNNQAAERVVNQLL 438



Score = 97.1 bits (240), Expect = 4e-19
Identities = 45/106 (42%), Positives = 67/106 (63%)
Frame = -1

Query: 320 IKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVANDAQANFIYVKGPELLNKYVGESE 141
+ H + Y LG++ G LL+GPPGC KT +A A+AN+ F+ V PE+++ GESE
Sbjct: 2 LPHVQVYAWLGVEPPRGVLLHGPPGCGKTALANAIANECGVPFLRVSAPEIVSGMSGESE 61

Query: 140 HSVRALFARARSCSPCIIFFDELDALAPRRGTDGNAVAERVLNQLL 3
+R LF AR +PCI+F DE+DA+ P+R T + R++ Q+L
Sbjct: 62 AKLRQLFNEARELAPCIVFIDEIDAIFPKRETAQREMERRIVAQML 107


>tr|A4S9B4|A4S9B4_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_37691 PE=3 SV=1
Length = 691

Score = 189 bits (481), Expect = 5e-47
Identities = 91/139 (65%), Positives = 113/139 (81%), Gaps = 1/139 (0%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ PNV W+DVG+L +++ L+F I+ I HPE ++ +GL++ TG LLYGPPGC K
Sbjct: 367 REGFTTTPNVTWDDVGSLTEIREELKFSIAEPIAHPERFQAMGLNISTGVLLYGPPGCGK 426

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TLVAKA AN+A ANFI +KGPELLNKYVGESE +VR LF RARS SPC++FFDE+D+LAP
Sbjct: 427 TLVAKATANEAMANFISIKGPELLNKYVGESERAVRTLFQRARSASPCVLFFDEMDSLAP 486

Query: 56 RRGTDG-NAVAERVLNQLL 3
RRG+ G N AERV+NQLL
Sbjct: 487 RRGSGGDNTSAERVVNQLL 505



Score = 98.2 bits (243), Expect = 2e-19
Identities = 50/130 (38%), Positives = 77/130 (59%)
Frame = -1

Query: 392 NVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVA 213
+VK D+G + K ++ I + HPE Y LG+D G LL+GPPGC KT +A A+A
Sbjct: 58 SVKLSDLGGIEDSLKDIKELILCPLMHPELYAWLGVDPPRGVLLHGPPGCGKTTLAHAIA 117

Query: 212 NDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGNA 33
+A+ F + E+++ GESE +R LF A + +P +IF DE+DA+ P+R +
Sbjct: 118 QEAKVPFFSIAATEIVSGMSGESEAKIRELFQSAAAHAPSLIFIDEIDAIVPKRESAQRE 177

Query: 32 VAERVLNQLL 3
+ R++ QLL
Sbjct: 178 MERRIVAQLL 187


>tr|Q00T93|Q00T93_OSTTA 26S proteasome regulatory complex, ATPase RPT1
(ISS) OS=Ostreococcus tauri GN=Ot17g01960 PE=3 SV=1
Length = 930

Score = 189 bits (480), Expect = 6e-47
Identities = 91/139 (65%), Positives = 113/139 (81%), Gaps = 1/139 (0%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ PNV W+DVG+L +++ L+F I+ I HPE ++ +GL++ TG LLYGPPGC K
Sbjct: 608 REGFTTTPNVTWDDVGSLTEVREELKFSIAEPIAHPERFQAMGLNISTGVLLYGPPGCGK 667

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TLVAKA AN+A ANFI +KGPELLNKYVGESE +VR LF RARS SPC++FFDE+D+LAP
Sbjct: 668 TLVAKATANEAMANFISIKGPELLNKYVGESERAVRTLFQRARSASPCVLFFDEMDSLAP 727

Query: 56 RRGTDG-NAVAERVLNQLL 3
RRG+ G N AERV+NQLL
Sbjct: 728 RRGSGGDNTSAERVVNQLL 746



Score = 97.8 bits (242), Expect = 2e-19
Identities = 49/129 (37%), Positives = 76/129 (58%)
Frame = -1

Query: 389 VKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVAN 210
V+ D+G + ++ I + HPE Y LG+D G LL+GPPGC KT +A A+A
Sbjct: 300 VRLSDLGGIEDSLHAIKELILCPLMHPELYAWLGVDPPRGVLLHGPPGCGKTTLAHAIAQ 359

Query: 209 DAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGNAV 30
+A+ F + E+++ GESE +R LF AR+ +P +IF DE+DA+ P+R + +
Sbjct: 360 EARVPFFSIAATEIVSGMSGESEAKIRELFLTARANAPSLIFIDEIDAIVPKRESAQREM 419

Query: 29 AERVLNQLL 3
R++ QLL
Sbjct: 420 ERRIVAQLL 428


>tr|Q5VRN1|Q5VRN1_ORYSJ Os06g0109400 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0004I20.8 PE=3 SV=1
Length = 770

Score = 185 bits (470), Expect = 9e-46
Identities = 88/138 (63%), Positives = 112/138 (81%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGFS+IP+V W+DVG L SL+K + +I R IK PE+Y+ GL+M GFLL+GPPGC K
Sbjct: 483 REGFSSIPDVTWDDVGGLDSLRKEFDRYIIRCIKQPEEYKTFGLNMQAGFLLFGPPGCGK 542

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKAVA++A ANFI++KGPELLNKYVGESE VR +F RA++ +PCI+FFDE+DAL
Sbjct: 543 TLIAKAVAHEAGANFIHIKGPELLNKYVGESESEVRKIFIRAQTNTPCILFFDEVDALTT 602

Query: 56 RRGTDGNAVAERVLNQLL 3
+RG +G V ER+LNQLL
Sbjct: 603 KRGKEGGWVVERLLNQLL 620



Score = 89.4 bits (220), Expect = 8e-17
Identities = 45/127 (35%), Positives = 74/127 (58%)
Frame = -1

Query: 383 WEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVANDA 204
+ D+G + S+ + L + + HPE LG+ G LL+GPPGC KT +A A+AN+
Sbjct: 190 FSDLGGMESVIEQLMMEVVVPLCHPEVPRWLGVKPVAGLLLHGPPGCGKTTLAHAIANET 249

Query: 203 QANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGNAVAE 24
F + PE+++ G SE ++R+LF +A +P I+F DE+DA+A +R +
Sbjct: 250 GVPFYKISAPEVVSGVSGASEENIRSLFKKAYRTAPSIVFIDEIDAIASKRENLQREMER 309

Query: 23 RVLNQLL 3
R++ QL+
Sbjct: 310 RIVTQLM 316


>tr|B8B1J7|B8B1J7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21333 PE=4 SV=1
Length = 770

Score = 185 bits (470), Expect = 9e-46
Identities = 88/138 (63%), Positives = 112/138 (81%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGFS+IP+V W+DVG L SL+K + +I R IK PE+Y+ GL+M GFLL+GPPGC K
Sbjct: 483 REGFSSIPDVTWDDVGGLDSLRKEFDRYIIRCIKQPEEYKTFGLNMQAGFLLFGPPGCGK 542

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKAVA++A ANFI++KGPELLNKYVGESE VR +F RA++ +PCI+FFDE+DAL
Sbjct: 543 TLIAKAVAHEAGANFIHIKGPELLNKYVGESESEVRKIFIRAQTNTPCILFFDEVDALTT 602

Query: 56 RRGTDGNAVAERVLNQLL 3
+RG +G V ER+LNQLL
Sbjct: 603 KRGKEGGWVVERLLNQLL 620



Score = 89.4 bits (220), Expect = 8e-17
Identities = 45/127 (35%), Positives = 74/127 (58%)
Frame = -1

Query: 383 WEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVANDA 204
+ D+G + S+ + L + + HPE LG+ G LL+GPPGC KT +A A+AN+
Sbjct: 190 FSDLGGMESVIEQLMMEVVVPLCHPEVPRWLGVKPVAGLLLHGPPGCGKTTLAHAIANET 249

Query: 203 QANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGNAVAE 24
F + PE+++ G SE ++R+LF +A +P I+F DE+DA+A +R +
Sbjct: 250 GVPFYKISAPEVVSGVSGASEENIRSLFKKAYRTAPSIVFIDEIDAIASKRENLQREMER 309

Query: 23 RVLNQLL 3
R++ QL+
Sbjct: 310 RIVTQLM 316


>tr|A3B7M8|A3B7M8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019050 PE=3 SV=1
Length = 797

Score = 185 bits (470), Expect = 9e-46
Identities = 88/138 (63%), Positives = 112/138 (81%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGFS+IP+V W+DVG L SL+K + +I R IK PE+Y+ GL+M GFLL+GPPGC K
Sbjct: 483 REGFSSIPDVTWDDVGGLDSLRKEFDRYIIRCIKQPEEYKTFGLNMQAGFLLFGPPGCGK 542

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKAVA++A ANFI++KGPELLNKYVGESE VR +F RA++ +PCI+FFDE+DAL
Sbjct: 543 TLIAKAVAHEAGANFIHIKGPELLNKYVGESESEVRKIFIRAQTNTPCILFFDEVDALTT 602

Query: 56 RRGTDGNAVAERVLNQLL 3
+RG +G V ER+LNQLL
Sbjct: 603 KRGKEGGWVVERLLNQLL 620



Score = 89.4 bits (220), Expect = 8e-17
Identities = 45/127 (35%), Positives = 74/127 (58%)
Frame = -1

Query: 383 WEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVANDA 204
+ D+G + S+ + L + + HPE LG+ G LL+GPPGC KT +A A+AN+
Sbjct: 190 FSDLGGMESVIEQLMMEVVVPLCHPEVPRWLGVKPVAGLLLHGPPGCGKTTLAHAIANET 249

Query: 203 QANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGNAVAE 24
F + PE+++ G SE ++R+LF +A +P I+F DE+DA+A +R +
Sbjct: 250 GVPFYKISAPEVVSGVSGASEENIRSLFKKAYRTAPSIVFIDEIDAIASKRENLQREMER 309

Query: 23 RVLNQLL 3
R++ QL+
Sbjct: 310 RIVTQLM 316


>tr|B8CDA1|B8CDA1_THAPS Nuclear vcp-like-like protein (Fragment)
OS=Thalassiosira pseudonana CCMP1335 GN=THAPSDRAFT_37748
PE=4 SV=1
Length = 605

Score = 181 bits (460), Expect = 1e-44
Identities = 88/141 (62%), Positives = 109/141 (77%), Gaps = 3/141 (2%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ +P+V W D+GAL +++ L + I HPE +E LGL + G LLYGPPGC K
Sbjct: 310 REGFATVPDVSWNDIGALSDIREELTLSVLEPIAHPEKFEALGLPLPAGVLLYGPPGCGK 369

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKA+AN++ ANFI VKGPELL+KYVGESE SVR +F RARS SPCIIFFDELD+L P
Sbjct: 370 TLLAKAIANESGANFISVKGPELLDKYVGESERSVRVVFERARSSSPCIIFFDELDSLCP 429

Query: 56 RRGTD---GNAVAERVLNQLL 3
+RG+D G V+ERV+NQLL
Sbjct: 430 KRGSDGGGGGGVSERVVNQLL 450



Score = 97.8 bits (242), Expect = 2e-19
Identities = 53/131 (40%), Positives = 76/131 (58%), Gaps = 6/131 (4%)
Frame = -1

Query: 377 DVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAVANDAQA 198
++G + SL + I + HPE + LG++ G LL GPPGC KT +AKA+A +
Sbjct: 1 NLGGVSSLLTTIRELIEYPLSHPELFLHLGVEPPRGVLLRGPPGCGKTHLAKAIAGELNV 60

Query: 197 NFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGT------DGN 36
++ V PEL+ GESE VR LF A +P IIF DE+DA+AP+RG G
Sbjct: 61 SYFQVSAPELVGGVSGESELRVRTLFESAARYAPAIIFIDEIDAIAPKRGEGSGGGGGGK 120

Query: 35 AVAERVLNQLL 3
++ +R++ QLL
Sbjct: 121 SMEKRIVAQLL 131


>tr|B6A9M1|B6A9M1_9CRYT ATPase, AAA family protein
OS=Cryptosporidium muris RN66 GN=CMU_039810 PE=4 SV=1
Length = 680

Score = 180 bits (457), Expect = 3e-44
Identities = 86/138 (62%), Positives = 106/138 (76%)
Frame = -1

Query: 416 REGFSAIPNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEK 237
REGF+ IP+ W+DVGAL L+K LE I IKH Y+ LGLD +G LLYGPPGC K
Sbjct: 386 REGFTMIPDTSWDDVGALDELRKDLELRIIAPIKHAHIYDSLGLDTPSGILLYGPPGCGK 445

Query: 236 TLVAKAVANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAP 57
TL+AKA+A ++ ANFI ++GPELLNKYVGESE +VR +F RARS +PCI+FFDELD+L
Sbjct: 446 TLLAKAIARESNANFISIRGPELLNKYVGESERAVRTVFERARSSAPCIVFFDELDSLCA 505

Query: 56 RRGTDGNAVAERVLNQLL 3
R +DGN +ERV+NQLL
Sbjct: 506 ARSSDGNGASERVVNQLL 523



Score = 95.1 bits (235), Expect = 2e-18
Identities = 46/129 (35%), Positives = 74/129 (57%)
Frame = -1

Query: 395 PNVKWEDVGALGSLQKCLEFFISRRIKHPEDYEMLGLDMDTGFLLYGPPGCEKTLVAKAV 216
P+ + D+G + ++K +E FI R IK PE Y+ +G+ G LL GPPG KT ++ +
Sbjct: 71 PSARLSDIGGIDHIKKDIEEFIIRPIKKPELYKRIGVSAPCGILLQGPPGTGKTHLSLCI 130

Query: 215 ANDAQANFIYVKGPELLNKYVGESEHSVRALFARARSCSPCIIFFDELDALAPRRGTDGN 36
A + F V GP L++ G SE ++R LF A +PC + DE+D ++P+R +G
Sbjct: 131 AGEVGLPFFRVSGPSLISGMSGSSEATLRRLFDNAVENAPCFVLIDEIDIISPKREGNGR 190

Query: 35 AVAERVLNQ 9
+ R++ Q
Sbjct: 191 DMERRIVAQ 199