BP913877
Clone id YMU001_000037_D03
Library
Length 585
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_D03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAAATTACGACACACACCTCTCAAGACCATCAGCCTCCTTTCTTCATGGCCTCTTTAGTT
TGCTTGAAGTCCCTGACAAACATTCTAGGGGCTATGGCCATAGACATCAGTTCTTGGAAT
AGAAGTTTGCAAGCGTAAGGAATGTGCACCTGTACAATTTCTGTTTTGTTCTTGCAACCC
CGGACATTCAAATGTGCTTTTCTTCAGGTTTGCAATTGCCATCAAGCCACAATGTTCACA
AACATGAATCCTATATGCATCACTCTGATCGAACAGCCTTTCTTTGAGGAAATGCGCAGC
TCCATGAGCTATCATACAGTCACGCTCCATTTCCCCAAATCGCAAACCTCCATCTCGGGA
TCGCCCTTCAGCTGGTTGTCGTGTTAGAATCTGGACAGGCCCACGACCACGAGAATGTAT
TTTATCATCAACCATGTGCTTCAGCCGCTGATAGTACGTAGGTCCTAAAAATATCATCGC
ATTCAGCGTCGGCCAGTATGCCCGTTGTACATTGTTTCGAATCCCCTCATTTGATATCCA
CACTTGTGCAAAGCTTTACTTATGTTGTCGACCGTAACATCCGTA
■■Homology search results ■■ -
sp_hit_id Q42877
Definition sp|Q42877|RPB2_SOLLC DNA-directed RNA polymerase II subunit RPB2 OS=Solanum lycopersicum
Align length 107
Score (bit) 206.0
E-value 1.0e-68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913877|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_D03.
(585 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q42877|RPB2_SOLLC DNA-directed RNA polymerase II subunit RPB2... 206 1e-68
sp|P38420|RPB2_ARATH DNA-directed RNA polymerase II subunit RPB2... 204 6e-67
sp|Q753Q4|RPB2_ASHGO DNA-directed RNA polymerase II subunit RPB2... 167 2e-63
sp|P08266|RPB2_DROME DNA-directed RNA polymerase II subunit RPB2... 180 2e-62
sp|Q8CFI7|RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2... 173 4e-59
sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2... 173 4e-59
sp|Q8SR75|RPB2_ENCCU DNA-directed RNA polymerase II subunit RPB2... 157 7e-52
sp|Q54J75|RPB2_DICDI DNA-directed RNA polymerase II subunit rpb2... 188 1e-47
sp|Q10578|RPB2_CAEEL DNA-directed RNA polymerase II subunit RPB2... 163 3e-45
sp|A5DHT2|RPB2_PICGU DNA-directed RNA polymerase II subunit RPB2... 172 1e-42
sp|Q02061|RPB2_SCHPO DNA-directed RNA polymerase II subunit RPB2... 169 1e-41
sp|P08518|RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2... 166 8e-41
sp|Q6FLD5|RPB2_CANGA DNA-directed RNA polymerase II subunit RPB2... 166 8e-41
sp|P22276|RPC2_YEAST DNA-directed RNA polymerase III subunit RPC... 130 6e-38
sp|Q7T6X7|RPO2_MIMIV DNA-directed RNA polymerase subunit 2 OS=Ac... 129 1e-37
sp|Q10233|RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC... 128 5e-37
sp|Q60181|RPOB1_METJA DNA-directed RNA polymerase subunit B' OS=... 130 6e-37
sp|P59470|RPC2_MOUSE DNA-directed RNA polymerase III subunit RPC... 125 1e-35
sp|Q9NW08|RPC2_HUMAN DNA-directed RNA polymerase III subunit RPC... 125 1e-35
sp|P25167|RPC2_DROME DNA-directed RNA polymerase III subunit RPC... 124 3e-35
sp|O28392|RPOB1_ARCFU DNA-directed RNA polymerase subunit B' OS=... 124 7e-35
sp|P09845|RPOB1_METTW DNA-directed RNA polymerase subunit B' OS=... 134 6e-34
sp|P11513|RPOB_SULAC DNA-directed RNA polymerase subunit B OS=Su... 126 5e-33
sp|Q54IZ9|RPC2_DICDI DNA-directed RNA polymerase III subunit rpc... 115 5e-33
sp|P31814|RPOB_THECE DNA-directed RNA polymerase subunit B OS=Th... 132 5e-33
sp|P41557|RPOB1_METVS DNA-directed RNA polymerase subunit B' OS=... 130 4e-32
sp|Q03587|RPOB_THEAC DNA-directed RNA polymerase subunit B OS=Th... 129 2e-31
sp|O27124|RPOB1_METTH DNA-directed RNA polymerase subunit B' OS=... 134 3e-31
sp|P15351|RPOB1_HALSA DNA-directed RNA polymerase subunit B' OS=... 134 3e-31
sp|P28365|RPA2_EUPOC DNA-directed RNA polymerase I subunit RPA2 ... 118 2e-26

>sp|Q42877|RPB2_SOLLC DNA-directed RNA polymerase II subunit RPB2
OS=Solanum lycopersicum GN=RPB2 PE=2 SV=1
Length = 1191

Score = 206 bits (523), Expect(2) = 1e-68
Identities = 96/107 (89%), Positives = 103/107 (96%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L+AMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1041 LSAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1100

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQ 166
HGAAHFLKERLFDQSDAYR+HVCE CGL+AIANLKK++FEC G + +
Sbjct: 1101 HGAAHFLKERLFDQSDAYRVHVCERCGLIAIANLKKNSFECRGCKNK 1147



Score = 74.7 bits (182), Expect(2) = 1e-68
Identities = 33/33 (100%), Positives = 33/33 (100%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR
Sbjct: 1008 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 1040



Score = 84.0 bits (206), Expect = 5e-16
Identities = 39/56 (69%), Positives = 44/56 (78%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEAMKKG 36
+K RGCKNKT+IVQVHIPYACKLLFQELM+MAIAPRM +D K K+ KKG
Sbjct: 1135 KKNSFECRGCKNKTDIVQVHIPYACKLLFQELMAMAIAPRMLTKDVKLAKDQKKKG 1190


>sp|P38420|RPB2_ARATH DNA-directed RNA polymerase II subunit RPB2
OS=Arabidopsis thaliana GN=RPB135 PE=2 SV=2
Length = 1188

Score = 204 bits (519), Expect(2) = 6e-67
Identities = 96/107 (89%), Positives = 102/107 (95%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L AMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1042 LTAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1101

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQ 166
HGAAHFLKERLFDQSDAYR+HVCE CGL+AIANLKK++FEC G + +
Sbjct: 1102 HGAAHFLKERLFDQSDAYRVHVCEVCGLIAIANLKKNSFECRGCKNK 1148



Score = 70.5 bits (171), Expect(2) = 6e-67
Identities = 31/32 (96%), Positives = 31/32 (96%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGR 489
TDVTVDNISKALHKCGYQMRGFE MYNGHTGR
Sbjct: 1009 TDVTVDNISKALHKCGYQMRGFERMYNGHTGR 1040



Score = 75.1 bits (183), Expect = 2e-13
Identities = 35/50 (70%), Positives = 39/50 (78%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTK 54
+K RGCKNKT+IVQV+IPYACKLLFQELMSMAIAPRM + K K
Sbjct: 1136 KKNSFECRGCKNKTDIVQVYIPYACKLLFQELMSMAIAPRMLTKHLKSAK 1185


>sp|Q753Q4|RPB2_ASHGO DNA-directed RNA polymerase II subunit RPB2
OS=Ashbya gossypii GN=RPB2 PE=3 SV=1
Length = 1222

Score = 167 bits (423), Expect(3) = 2e-63
Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 1/108 (0%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L A IF GPTYYQRL+HMVDDKIH+R RGP+Q+LTRQP EGRSRDGGLRFGEMERDCMIA
Sbjct: 1079 LMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIA 1138

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLM-AIANLKKSTFECPGLQEQ 166
HGAA FLKERL + SDA+R+H+C CGLM +A LK + FEC G + +
Sbjct: 1139 HGAAAFLKERLMEASDAFRVHICGICGLMTVVAKLKHNQFECRGCKNK 1186



Score = 62.0 bits (149), Expect(3) = 2e-63
Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 3/42 (7%)
Frame = -2

Query: 182 RGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFV---RDF 66
RGCKNK +I QVHIPYA KLLFQELM+M IAPR++ RDF
Sbjct: 1181 RGCKNKIDIYQVHIPYAAKLLFQELMAMNIAPRLYTDRSRDF 1222



Score = 54.7 bits (130), Expect(3) = 2e-63
Identities = 24/35 (68%), Positives = 28/35 (80%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR*M 480
TD+TVD ISK L + GYQ RGFE MYNGHTG++ M
Sbjct: 1046 TDITVDGISKLLREHGYQSRGFEVMYNGHTGKKLM 1080


>sp|P08266|RPB2_DROME DNA-directed RNA polymerase II subunit RPB2
OS=Drosophila melanogaster GN=RpII140 PE=2 SV=2
Length = 1176

Score = 180 bits (457), Expect(3) = 2e-62
Identities = 80/109 (73%), Positives = 94/109 (86%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
+NA +FLGPTYYQRLKHMVDDKIHSR RGPVQIL RQP EGR+RDGGLRFGEMERDC I+
Sbjct: 1039 INAQVFLGPTYYQRLKHMVDDKIHSRARGPVQILVRQPMEGRARDGGLRFGEMERDCQIS 1098

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQNR 160
HGAA FL+ERLF+ SD YR+H+C CGL+AIANL+ +TFEC G + + +
Sbjct: 1099 HGAAQFLRERLFEVSDPYRVHICNFCGLIAIANLRNNTFECKGCKNKTQ 1147



Score = 59.3 bits (142), Expect(3) = 2e-62
Identities = 27/36 (75%), Positives = 31/36 (86%)
Frame = -2

Query: 182 RGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFV 75
+GCKNKT+I QV +PYA KLLFQELMSM IAPR+ V
Sbjct: 1140 KGCKNKTQISQVRLPYAAKLLFQELMSMNIAPRLMV 1175



Score = 40.8 bits (94), Expect(3) = 2e-62
Identities = 18/31 (58%), Positives = 21/31 (67%)
Frame = -2

Query: 578 VTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
V V IS L + GY +RG E MYNGHTGR+
Sbjct: 1008 VNVQKISTFLQEYGYHLRGNEVMYNGHTGRK 1038


>sp|Q8CFI7|RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2
OS=Mus musculus GN=Polr2b PE=2 SV=2
Length = 1174

Score = 173 bits (438), Expect(3) = 4e-59
Identities = 77/109 (70%), Positives = 91/109 (83%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
+ + IF+GPTYYQRLKHMVDDKIHSR RGP+QIL RQP EGRSRDGGLRFGEMERDC IA
Sbjct: 1037 ITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIA 1096

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQNR 160
HGAA FL+ERLF+ SD Y++HVC CG+MAIAN + T+EC G + + +
Sbjct: 1097 HGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQ 1145



Score = 60.5 bits (145), Expect(3) = 4e-59
Identities = 27/34 (79%), Positives = 31/34 (91%)
Frame = -2

Query: 182 RGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRM 81
RGC+NKT+I V +PYACKLLFQELMSM+IAPRM
Sbjct: 1138 RGCRNKTQISLVRMPYACKLLFQELMSMSIAPRM 1171



Score = 35.8 bits (81), Expect(3) = 4e-59
Identities = 16/31 (51%), Positives = 19/31 (61%)
Frame = -2

Query: 578 VTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
V V IS L GY +RG E +YNG TGR+
Sbjct: 1006 VNVQKISNLLSDYGYHLRGNEVLYNGFTGRK 1036


>sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2
OS=Homo sapiens GN=POLR2B PE=1 SV=1
Length = 1174

Score = 173 bits (438), Expect(3) = 4e-59
Identities = 77/109 (70%), Positives = 91/109 (83%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
+ + IF+GPTYYQRLKHMVDDKIHSR RGP+QIL RQP EGRSRDGGLRFGEMERDC IA
Sbjct: 1037 ITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIA 1096

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQNR 160
HGAA FL+ERLF+ SD Y++HVC CG+MAIAN + T+EC G + + +
Sbjct: 1097 HGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQ 1145



Score = 60.5 bits (145), Expect(3) = 4e-59
Identities = 27/34 (79%), Positives = 31/34 (91%)
Frame = -2

Query: 182 RGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRM 81
RGC+NKT+I V +PYACKLLFQELMSM+IAPRM
Sbjct: 1138 RGCRNKTQISLVRMPYACKLLFQELMSMSIAPRM 1171



Score = 35.8 bits (81), Expect(3) = 4e-59
Identities = 16/31 (51%), Positives = 19/31 (61%)
Frame = -2

Query: 578 VTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
V V IS L GY +RG E +YNG TGR+
Sbjct: 1006 VNVQKISNLLSDYGYHLRGNEVLYNGFTGRK 1036


>sp|Q8SR75|RPB2_ENCCU DNA-directed RNA polymerase II subunit RPB2
OS=Encephalitozoon cuniculi GN=RPB2 PE=3 SV=1
Length = 1141

Score = 157 bits (396), Expect(3) = 7e-52
Identities = 74/103 (71%), Positives = 85/103 (82%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L A +F GPTYYQRLKHMVDDKIH+R RGP+QILTRQP EGRSRDGGLRFGEMERDC+I+
Sbjct: 1005 LRAQMFFGPTYYQRLKHMVDDKIHARARGPLQILTRQPVEGRSRDGGLRFGEMERDCIIS 1064

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPG 178
HGA+ FLKERL D SDAY +VC+ CGL+A+ K + EC G
Sbjct: 1065 HGASAFLKERLMDVSDAYSCYVCDFCGLLAMGGSKVN--ECKG 1105



Score = 46.2 bits (108), Expect(3) = 7e-52
Identities = 21/34 (61%), Positives = 24/34 (70%)
Frame = -2

Query: 182 RGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRM 81
+GC N T + V IPYA KLL QELM M IAPR+
Sbjct: 1104 KGCNNTTNVSMVEIPYAFKLLIQELMGMNIAPRI 1137



Score = 42.0 bits (97), Expect(3) = 7e-52
Identities = 19/31 (61%), Positives = 21/31 (67%)
Frame = -2

Query: 578 VTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
VTVD IS L G+Q RG E MYNG TGR+
Sbjct: 974 VTVDGISSRLKSYGFQQRGLEVMYNGMTGRK 1004


>sp|Q54J75|RPB2_DICDI DNA-directed RNA polymerase II subunit rpb2
OS=Dictyostelium discoideum GN=polr2b PE=3 SV=1
Length = 1170

Score = 188 bits (478), Expect = 1e-47
Identities = 85/101 (84%), Positives = 96/101 (95%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
++A IF+GPTYYQRLKHMVDDKIHSR RGPVQILTRQP EGRSRDGGLRFGEMERDCMI+
Sbjct: 1032 MDAQIFIGPTYYQRLKHMVDDKIHSRSRGPVQILTRQPVEGRSRDGGLRFGEMERDCMIS 1091

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFEC 184
HGAA FLKERLFDQSD+YR+H+C+ CGL+AIANLKK++FEC
Sbjct: 1092 HGAAQFLKERLFDQSDSYRVHICDICGLIAIANLKKNSFEC 1132



Score = 89.7 bits (221), Expect = 9e-18
Identities = 69/189 (36%), Positives = 91/189 (48%), Gaps = 18/189 (9%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR*MR*YF*DLRTISG*STWLMIKYIL-- 411
TDVTV+ IS+ALHK GYQM G E MYNGHTGRR D + G + + +K+++
Sbjct: 999 TDVTVEAISQALHKIGYQMTGHEVMYNGHTGRRM------DAQIFIGPTYYQRLKHMVDD 1052

Query: 410 ----------------VVVGLSRF*HDNQLKGDPEMEVCDLGKWSVTV**LMELRISSKK 279
V G SR D L+ C + + L E
Sbjct: 1053 KIHSRSRGPVQILTRQPVEGRSR---DGGLRFGEMERDCMISHGAAQF--LKERLFDQSD 1107

Query: 278 GCSIRVMHIGFMFVNIVA*WQLQT*RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSM 99
+ + I ++A L +K R CKNKT+I Q+ +PYA KLLFQELMSM
Sbjct: 1108 SYRVHICDI----CGLIAIANL---KKNSFECRRCKNKTQISQIRMPYAAKLLFQELMSM 1160

Query: 98 AIAPRMFVR 72
+IAPRMF +
Sbjct: 1161 SIAPRMFTQ 1169


>sp|Q10578|RPB2_CAEEL DNA-directed RNA polymerase II subunit RPB2
OS=Caenorhabditis elegans GN=rbp-2 PE=2 SV=2
Length = 1193

Score = 163 bits (413), Expect(2) = 3e-45
Identities = 74/119 (62%), Positives = 92/119 (77%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L IF GPTYYQRLKHMVDDKIHSR RGP+Q++ RQP EGR+RDGGLRFGEMERDC I+
Sbjct: 1043 LTTQIFFGPTYYQRLKHMVDDKIHSRARGPIQMMNRQPMEGRARDGGLRFGEMERDCQIS 1102

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQNRNCTGAHSLRL 130
HGA FL+ERLF+ SD Y ++VC +CGL+ +ANL+ ++FEC RN T ++R+
Sbjct: 1103 HGATQFLRERLFEVSDPYHVYVCNNCGLIVVANLRTNSFECKAC----RNKTQVSAVRI 1157



Score = 38.5 bits (88), Expect(2) = 3e-45
Identities = 17/31 (54%), Positives = 21/31 (67%)
Frame = -2

Query: 578 VTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
V V IS L + GY +RG E MYNGHTG++
Sbjct: 1012 VNVQKISGLLCEYGYHLRGNEVMYNGHTGKK 1042



Score = 59.7 bits (143), Expect = 1e-08
Identities = 27/45 (60%), Positives = 37/45 (82%)
Frame = -2

Query: 182 RGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEA 48
+ C+NKT++ V IPYACKLLFQELMSM+IAPR+ V+ +Q+K +
Sbjct: 1144 KACRNKTQVSAVRIPYACKLLFQELMSMSIAPRLMVKP-RQSKRS 1187


>sp|A5DHT2|RPB2_PICGU DNA-directed RNA polymerase II subunit RPB2
OS=Pichia guilliermondii GN=RPB2 PE=3 SV=3
Length = 1236

Score = 172 bits (435), Expect = 1e-42
Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 1/102 (0%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L A +F GPTYYQRL+HMVDDKIH+R RGPVQ+LTRQP EGRSRDGGLRFGEMERDCMIA
Sbjct: 1090 LMAQVFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIA 1149

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMA-IANLKKSTFEC 184
HGAA FLKERL + SDA+R+HVC CGLM+ IANLKK+ FEC
Sbjct: 1150 HGAAGFLKERLMEASDAFRVHVCGVCGLMSVIANLKKNQFEC 1191



Score = 79.7 bits (195), Expect = 1e-14
Identities = 62/188 (32%), Positives = 89/188 (47%), Gaps = 19/188 (10%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR*MR*YF*DLRTISG*STWLMIKYIL-- 411
TDVT + +SK L + GYQ RGFE MY+GHTG++ M F G + + +++++
Sbjct: 1057 TDVTAEAVSKLLREHGYQSRGFEVMYHGHTGKKLMAQVF------FGPTYYQRLRHMVDD 1110

Query: 410 ----------------VVVGLSRF*HDNQLKGDPEMEVCDLGKWSVTV**LMELRISSKK 279
V G SR D L+ C + + L E + +
Sbjct: 1111 KIHARARGPVQVLTRQPVEGRSR---DGGLRFGEMERDCMIAHGAAGF--LKERLMEASD 1165

Query: 278 GCSIRVMHI-GFMFVNIVA*WQLQT*RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMS 102
+ V + G M V + +K R CKNKT I Q+HIPYA KLLFQELM+
Sbjct: 1166 AFRVHVCGVCGLMSV-------IANLKKNQFECRSCKNKTNIYQIHIPYAAKLLFQELMA 1218

Query: 101 MAIAPRMF 78
M I+PR++
Sbjct: 1219 MNISPRLY 1226


tr_hit_id A9SJE5
Definition tr|A9SJE5|A9SJE5_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 103
Score (bit) 205.0
E-value 1.0e-84
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913877|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_D03.
(585 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SJE5|A9SJE5_PHYPA Predicted protein OS=Physcomitrella paten... 205 1e-84
tr|Q1L5Z3|Q1L5Z3_ANTMA DNA-directed RNA polymerase OS=Antirrhinu... 200 2e-81
tr|Q1L5Z2|Q1L5Z2_PETHY DNA-directed RNA polymerase OS=Petunia hy... 201 1e-79
tr|Q1L5B4|Q1L5B4_RHOMC DNA-directed RNA polymerase OS=Rhododendr... 194 2e-76
tr|Q1L5Z0|Q1L5Z0_NICSY DNA-directed RNA polymerase (Fragment) OS... 207 5e-68
tr|A7PJ31|A7PJ31_VITVI DNA-directed RNA polymerase OS=Vitis vini... 205 1e-67
tr|A5C1N0|A5C1N0_VITVI DNA-directed RNA polymerase OS=Vitis vini... 205 1e-67
tr|Q1L5Y8|Q1L5Y8_ANTMA DNA-directed RNA polymerase OS=Antirrhinu... 205 2e-67
tr|Q1L5Y9|Q1L5Y9_PETHY DNA-directed RNA polymerase OS=Petunia hy... 204 2e-67
tr|Q1L5B5|Q1L5B5_RHOMC DNA-directed RNA polymerase OS=Rhododendr... 204 2e-67
tr|Q70LQ0|Q70LQ0_SOLLC DNA-directed RNA polymerase (Fragment) OS... 204 4e-67
tr|Q1L5A5|Q1L5A5_9ERIC DNA-directed RNA polymerase (Fragment) OS... 202 1e-66
tr|Q1ANE9|Q1ANE9_9BRYO RNA polymerase II second largest subunit ... 204 3e-66
tr|Q10G20|Q10G20_ORYSJ DNA-directed RNA polymerase OS=Oryza sati... 201 5e-66
tr|A2XK42|A2XK42_ORYSI DNA-directed RNA polymerase OS=Oryza sati... 201 5e-66
tr|A3AKU7|A3AKU7_ORYSJ DNA-directed RNA polymerase OS=Oryza sati... 201 5e-66
tr|Q0DQ04|Q0DQ04_ORYSJ DNA-directed RNA polymerase (Fragment) OS... 201 5e-66
tr|Q70LP7|Q70LP7_MIMGU DNA-directed RNA polymerase (Fragment) OS... 202 6e-66
tr|A4RQU3|A4RQU3_OSTLU DNA-directed RNA polymerase OS=Ostreococc... 187 7e-66
tr|O82455|O82455_9GENT DNA-directed RNA polymerase (Fragment) OS... 200 8e-66
tr|Q01GR3|Q01GR3_OSTTA DNA-directed RNA polymerase OS=Ostreococc... 187 1e-65
tr|O82452|O82452_KOPFR DNA-directed RNA polymerase (Fragment) OS... 203 1e-65
tr|Q9XGB8|Q9XGB8_9GENT DNA-directed RNA polymerase (Fragment) OS... 203 2e-65
tr|Q1L5Z4|Q1L5Z4_NICSY DNA-directed RNA polymerase OS=Nicotiana ... 202 4e-65
tr|Q1ANF0|Q1ANF0_COLSC DNA-directed RNA polymerase (Fragment) OS... 198 5e-65
tr|O82453|O82453_9GENT DNA-directed RNA polymerase (Fragment) OS... 200 9e-65
tr|Q1ANF2|Q1ANF2_9VIRI DNA-directed RNA polymerase (Fragment) OS... 203 2e-64
tr|Q70PI0|Q70PI0_9LAMI DNA-directed RNA polymerase (Fragment) OS... 195 2e-64
tr|Q9XFW0|Q9XFW0_BUDAS DNA-directed RNA polymerase (Fragment) OS... 195 3e-64
tr|Q70Q06|Q70Q06_VICSA DNA-directed RNA polymerase (Fragment) OS... 193 5e-64

>tr|A9SJE5|A9SJE5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_165263 PE=4 SV=1
Length = 1185

Score = 205 bits (521), Expect(3) = 1e-84
Identities = 95/103 (92%), Positives = 100/103 (97%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L A IFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1034 LTAHIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1093

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPG 178
HGAAHFLKERLFDQSDAYR+HVCEHCG++AIANLKK+T+EC G
Sbjct: 1094 HGAAHFLKERLFDQSDAYRVHVCEHCGIIAIANLKKNTYECRG 1136



Score = 80.5 bits (197), Expect(3) = 1e-84
Identities = 38/55 (69%), Positives = 42/55 (76%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEAMKK 39
+K RGCKN T+IVQVHIPYACKLLFQELMSMAIAPRMF ++ K E KK
Sbjct: 1128 KKNTYECRGCKNNTDIVQVHIPYACKLLFQELMSMAIAPRMFTKELKMRSEHAKK 1182



Score = 72.8 bits (177), Expect(3) = 1e-84
Identities = 32/33 (96%), Positives = 32/33 (96%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
TDVTVDNISKALHKCGYQMRGFE MYNGHTGRR
Sbjct: 1001 TDVTVDNISKALHKCGYQMRGFEVMYNGHTGRR 1033


>tr|Q1L5Z3|Q1L5Z3_ANTMA DNA-directed RNA polymerase OS=Antirrhinum
majus GN=RPB2 PE=2 SV=1
Length = 1198

Score = 200 bits (509), Expect(3) = 2e-81
Identities = 93/101 (92%), Positives = 97/101 (96%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L +MIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1048 LTSMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1107

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFEC 184
HGAAHFLKERLFDQSDAYR+HVCE CGLM IANLKK ++EC
Sbjct: 1108 HGAAHFLKERLFDQSDAYRVHVCERCGLMGIANLKKHSYEC 1148



Score = 74.7 bits (182), Expect(3) = 2e-81
Identities = 35/57 (61%), Positives = 40/57 (70%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEAMKKGG 33
+K R CKNKT+IVQ++IPYACKLL QELMSMAIAPR+ D K K K GG
Sbjct: 1142 KKHSYECRSCKNKTDIVQIYIPYACKLLIQELMSMAIAPRLLTNDVKSVKGQSKTGG 1198



Score = 72.8 bits (177), Expect(3) = 2e-81
Identities = 32/32 (100%), Positives = 32/32 (100%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGR 489
TDVTVDNISKALHKCGYQMRGFETMYNGHTGR
Sbjct: 1015 TDVTVDNISKALHKCGYQMRGFETMYNGHTGR 1046


>tr|Q1L5Z2|Q1L5Z2_PETHY DNA-directed RNA polymerase OS=Petunia hybrida
GN=RPB2 PE=2 SV=1
Length = 1203

Score = 201 bits (512), Expect(3) = 1e-79
Identities = 95/101 (94%), Positives = 98/101 (97%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L AMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1055 LTAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1114

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFEC 184
HGAAHFLKERLFDQSDAYRIHVC+ CGL+AIANLKK +FEC
Sbjct: 1115 HGAAHFLKERLFDQSDAYRIHVCQQCGLIAIANLKKISFEC 1155



Score = 70.5 bits (171), Expect(3) = 1e-79
Identities = 31/32 (96%), Positives = 31/32 (96%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGR 489
TDVTVDNISKALHKCGYQMRGFE MYNGHTGR
Sbjct: 1022 TDVTVDNISKALHKCGYQMRGFERMYNGHTGR 1053



Score = 69.7 bits (169), Expect(3) = 1e-79
Identities = 32/47 (68%), Positives = 37/47 (78%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFK 63
+K R CKNKT+IVQV+IPYACKLL QELMSMAIAPRM ++ K
Sbjct: 1149 KKISFECRSCKNKTDIVQVYIPYACKLLIQELMSMAIAPRMLTKEVK 1195


>tr|Q1L5B4|Q1L5B4_RHOMC DNA-directed RNA polymerase OS=Rhododendron
macrophyllum GN=RPB2 PE=2 SV=1
Length = 1207

Score = 194 bits (494), Expect(3) = 2e-76
Identities = 91/101 (90%), Positives = 96/101 (95%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L IFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1059 LTYTIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1118

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFEC 184
HGAAHFLKERLFDQSDAYR+HVC CG++AIANLKK++FEC
Sbjct: 1119 HGAAHFLKERLFDQSDAYRVHVCALCGIVAIANLKKNSFEC 1159



Score = 70.5 bits (171), Expect(3) = 2e-76
Identities = 31/32 (96%), Positives = 31/32 (96%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGR 489
TDVTVDNISKALHKCGYQMRGFE MYNGHTGR
Sbjct: 1026 TDVTVDNISKALHKCGYQMRGFERMYNGHTGR 1057



Score = 66.2 bits (160), Expect(3) = 2e-76
Identities = 30/45 (66%), Positives = 36/45 (80%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRD 69
+K R CKNKT+IVQV+IPYACKLL QELM+MAIAPR+ +D
Sbjct: 1153 KKNSFECRHCKNKTDIVQVYIPYACKLLLQELMAMAIAPRLLTKD 1197


>tr|Q1L5Z0|Q1L5Z0_NICSY DNA-directed RNA polymerase (Fragment)
OS=Nicotiana sylvestris GN=RPB2 PE=2 SV=1
Length = 1087

Score = 207 bits (526), Expect(2) = 5e-68
Identities = 97/107 (90%), Positives = 103/107 (96%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L+AMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 944 LSAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1003

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQ 166
HGAAHFLKERLFDQSDAYR+HVCE CGL+AIANLKKS+FEC G + +
Sbjct: 1004 HGAAHFLKERLFDQSDAYRVHVCERCGLIAIANLKKSSFECRGCKNK 1050



Score = 74.7 bits (182), Expect(2) = 5e-68
Identities = 33/33 (100%), Positives = 33/33 (100%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR
Sbjct: 911 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 943



Score = 81.6 bits (200), Expect = 3e-14
Identities = 37/50 (74%), Positives = 42/50 (84%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTK 54
+K+ RGCKNKT+IVQVHIPYACKLLFQELM+MAIAPRM +D KQ K
Sbjct: 1038 KKSSFECRGCKNKTDIVQVHIPYACKLLFQELMAMAIAPRMLTKDVKQAK 1087


>tr|A7PJ31|A7PJ31_VITVI DNA-directed RNA polymerase OS=Vitis vinifera
GN=GSVIVT00018575001 PE=3 SV=1
Length = 1220

Score = 205 bits (522), Expect(2) = 1e-67
Identities = 96/107 (89%), Positives = 102/107 (95%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L AMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1070 LTAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1129

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQ 166
HGAAHFLKERLFDQSDAYR+HVCE CGL+AIANLKK++FEC G + +
Sbjct: 1130 HGAAHFLKERLFDQSDAYRVHVCERCGLIAIANLKKNSFECRGCKNK 1176



Score = 74.7 bits (182), Expect(2) = 1e-67
Identities = 33/33 (100%), Positives = 33/33 (100%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR
Sbjct: 1037 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 1069



Score = 82.4 bits (202), Expect = 2e-14
Identities = 38/56 (67%), Positives = 44/56 (78%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEAMKKG 36
+K RGCKNKT+IVQVHIPYACKLLFQELM+MAIAPRM ++ K K+ KKG
Sbjct: 1164 KKNSFECRGCKNKTDIVQVHIPYACKLLFQELMAMAIAPRMLTKEVKPPKDQKKKG 1219


>tr|A5C1N0|A5C1N0_VITVI DNA-directed RNA polymerase OS=Vitis vinifera
GN=VITISV_033708 PE=3 SV=1
Length = 1193

Score = 205 bits (522), Expect(2) = 1e-67
Identities = 96/107 (89%), Positives = 102/107 (95%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L AMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1043 LTAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1102

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQ 166
HGAAHFLKERLFDQSDAYR+HVCE CGL+AIANLKK++FEC G + +
Sbjct: 1103 HGAAHFLKERLFDQSDAYRVHVCERCGLIAIANLKKNSFECRGCKNK 1149



Score = 74.7 bits (182), Expect(2) = 1e-67
Identities = 33/33 (100%), Positives = 33/33 (100%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR
Sbjct: 1010 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 1042



Score = 82.4 bits (202), Expect = 2e-14
Identities = 38/56 (67%), Positives = 44/56 (78%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEAMKKG 36
+K RGCKNKT+IVQVHIPYACKLLFQELM+MAIAPRM ++ K K+ KKG
Sbjct: 1137 KKNSFECRGCKNKTDIVQVHIPYACKLLFQELMAMAIAPRMLTKEVKPPKDQKKKG 1192


>tr|Q1L5Y8|Q1L5Y8_ANTMA DNA-directed RNA polymerase OS=Antirrhinum
majus GN=RPB2 PE=2 SV=1
Length = 1200

Score = 205 bits (521), Expect(2) = 2e-67
Identities = 96/107 (89%), Positives = 103/107 (96%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L++MIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1050 LSSMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1109

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQ 166
HGAAHFLKERLFDQSDAYRIHVCE CGL+AIANLKK++FEC G + +
Sbjct: 1110 HGAAHFLKERLFDQSDAYRIHVCEQCGLIAIANLKKNSFECRGCKNK 1156



Score = 74.7 bits (182), Expect(2) = 2e-67
Identities = 33/33 (100%), Positives = 33/33 (100%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR
Sbjct: 1017 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 1049



Score = 87.4 bits (215), Expect = 5e-16
Identities = 41/55 (74%), Positives = 45/55 (81%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEAMKK 39
+K RGCKNKT+IVQVHIPYACKLLFQELMSMAIAPRM +D KQ+KE KK
Sbjct: 1144 KKNSFECRGCKNKTDIVQVHIPYACKLLFQELMSMAIAPRMLTKDIKQSKEQRKK 1198


>tr|Q1L5Y9|Q1L5Y9_PETHY DNA-directed RNA polymerase OS=Petunia hybrida
GN=RPB2 PE=2 SV=1
Length = 1195

Score = 204 bits (520), Expect(2) = 2e-67
Identities = 96/107 (89%), Positives = 102/107 (95%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L AMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1045 LPAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1104

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQ 166
HGAAHFLKERLFDQSDAYR+HVCE CGL+AIANLKK++FEC G + +
Sbjct: 1105 HGAAHFLKERLFDQSDAYRVHVCERCGLIAIANLKKNSFECRGCKNK 1151



Score = 74.7 bits (182), Expect(2) = 2e-67
Identities = 33/33 (100%), Positives = 33/33 (100%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR
Sbjct: 1012 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 1044



Score = 85.5 bits (210), Expect = 2e-15
Identities = 39/56 (69%), Positives = 45/56 (80%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEAMKKG 36
+K RGCKNKT+IVQVHIPYACKLLFQELM+MAIAPRM +D KQ ++ KKG
Sbjct: 1139 KKNSFECRGCKNKTDIVQVHIPYACKLLFQELMAMAIAPRMLTKDVKQARDQKKKG 1194


>tr|Q1L5B5|Q1L5B5_RHOMC DNA-directed RNA polymerase OS=Rhododendron
macrophyllum GN=RPB2 PE=2 SV=1
Length = 1191

Score = 204 bits (520), Expect(2) = 2e-67
Identities = 96/107 (89%), Positives = 102/107 (95%)
Frame = -1

Query: 486 LNAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 307
L +MIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA
Sbjct: 1041 LTSMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIA 1100

Query: 306 HGAAHFLKERLFDQSDAYRIHVCEHCGLMAIANLKKSTFECPGLQEQ 166
HGAAHFLKERLFDQSDAYRIHVCE CGL+AIANLKK++FEC G + +
Sbjct: 1101 HGAAHFLKERLFDQSDAYRIHVCERCGLIAIANLKKNSFECRGCKNK 1147



Score = 74.7 bits (182), Expect(2) = 2e-67
Identities = 33/33 (100%), Positives = 33/33 (100%)
Frame = -2

Query: 584 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 486
TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR
Sbjct: 1008 TDVTVDNISKALHKCGYQMRGFETMYNGHTGRR 1040



Score = 85.5 bits (210), Expect = 2e-15
Identities = 40/55 (72%), Positives = 44/55 (80%)
Frame = -2

Query: 203 RKAHLNVRGCKNKTEIVQVHIPYACKLLFQELMSMAIAPRMFVRDFKQTKEAMKK 39
+K RGCKNKT+IVQVHIPYACKLLFQELMSMAIAPRM +D KQ K+ KK
Sbjct: 1135 KKNSFECRGCKNKTDIVQVHIPYACKLLFQELMSMAIAPRMLTKDVKQAKDKKKK 1189