BP913896
Clone id YMU001_000037_E11
Library
Length 467
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_E11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGGTAAAGCAACACATTAAAAGGCTCAAAACATTTGAGAAGTTCATATAATCCAAGGGCA
ACACCCCGATGGCTTCCTGATTTGAATTTGATCGAGCAAAGCAATTCATGCATAATTACA
TTCGCCAGGATGTTTCAAGCACCATAAGGGTTGGATAGGCATGGCCTTGATGCCCCGAGA
AACCATGTGGTAGCGCCAATCGCTGAGGCGATAAAGAGCATCGACAGAGCGCCTCTCTCC
TTTACCATCCCGGTTGCCGGACCACAGGGACTCCGCCAGGGCAGATGCACGAGGCCACAA
AAGCCCGTCTAGAACAGTCTCATCTGCCTGCTCTGACCAAAGGCACACCTCCCCTCCCAT
CACAAGCCCTGCCTCTTCCTTTGTCAGGTTGTACGTGATATCGTAGTCGTAGATCCGTTG
CCATGTCTTGTATGGTGCGCACCATGACCCCCCGCTACCAGCATAAT
■■Homology search results ■■ -
sp_hit_id P43077
Definition sp|P43077|HEX1_CANAL Beta-hexosaminidase OS=Candida albicans
Align length 115
Score (bit) 125.0
E-value 1.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913896|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_E11.
(467 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P43077|HEX1_CANAL Beta-hexosaminidase OS=Candida albicans GN=... 125 1e-28
sp|Q8WSF3|FDL_DROME Probable beta-hexosaminidase fdl OS=Drosophi... 98 2e-20
sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylgluc... 88 2e-17
sp|P29416|HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus mu... 74 2e-13
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sa... 72 2e-12
sp|Q641X3|HEXA_RAT Beta-hexosaminidase subunit alpha OS=Rattus n... 71 3e-12
sp|P20060|HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus mus... 69 1e-11
sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis s... 69 1e-11
sp|Q5RC84|HEXA_PONAB Beta-hexosaminidase subunit alpha OS=Pongo ... 67 4e-11
sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo s... 67 4e-11
sp|Q6AXR4|HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus no... 67 5e-11
sp|Q0V8R6|HEXA_BOVIN Beta-hexosaminidase subunit alpha OS=Bos ta... 67 5e-11
sp|Q29548|HEXB_PIG Beta-hexosaminidase subunit beta OS=Sus scrof... 65 1e-10
sp|Q54K55|HEXB1_DICDI Beta-hexosaminidase subunit B1 OS=Dictyost... 64 3e-10
sp|Q22492|HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis ele... 60 4e-09
sp|Q54K56|HEXB2_DICDI Beta-hexosaminidase subunit B2 OS=Dictyost... 60 6e-09
sp|Q619W7|HEXA_CAEBR Beta-hexosaminidase A OS=Caenorhabditis bri... 60 6e-09
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyost... 58 2e-08
sp|Q54SC9|HEXA2_DICDI Beta-hexosaminidase subunit A2 OS=Dictyost... 52 1e-06
sp|P49009|HEXA_ENTHI Beta-hexosaminidase subunit alpha OS=Entamo... 45 2e-04
sp|Q86M34|HEXB_ENTHI Beta-hexosaminidase subunit beta OS=Entamoe... 38 0.019
sp|Q68DN1|CB016_HUMAN Uncharacterized protein C2orf16 OS=Homo sa... 34 0.28
sp|P25562|YCC2_YEAST Putative uncharacterized protein YCL022C OS... 31 3.1
sp|Q168C1|TRUA_ROSDO tRNA pseudouridine synthase A OS=Roseobacte... 30 4.0
sp|P45161|DACB_HAEIN D-alanyl-D-alanine carboxypeptidase dacB OS... 30 4.0
sp|O43603|GALR2_HUMAN Galanin receptor type 2 OS=Homo sapiens GN... 30 6.8
sp|Q9SK28|FH18_ARATH Formin-like protein 18 OS=Arabidopsis thali... 30 6.8
sp|A1AZF2|TRUA_PARDP tRNA pseudouridine synthase A OS=Paracoccus... 29 8.9
sp|Q9RUV7|RUVA_DEIRA Holliday junction ATP-dependent DNA helicas... 29 8.9
sp|A6KX96|G1091_BACV8 Glycosyl hydrolase family 109 protein 1 OS... 29 8.9

>sp|P43077|HEX1_CANAL Beta-hexosaminidase OS=Candida albicans
GN=HEX1 PE=1 SV=1
Length = 562

Score = 125 bits (313), Expect = 1e-28
Identities = 55/115 (47%), Positives = 74/115 (64%)
Frame = -3

Query: 459 GSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASA 280
G GGSWC PYK++QRIY++D T NLT+ E V+G E LWSEQ D TVL +WPR +A
Sbjct: 440 GQGGSWCGPYKSYQRIYNFDFTANLTETEKNHVLGREAALWSEQVDSTVLTTKIWPRTAA 499

Query: 279 LAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
LAE WSGN+D G R + R+ ++R ++V G P+ P +CL +P C+
Sbjct: 500 LAELTWSGNKDSNGHHRGYEFTQRILNFREYLVKLGYGVSPLVPKYCLLNPHACD 554


>sp|Q8WSF3|FDL_DROME Probable beta-hexosaminidase fdl OS=Drosophila
melanogaster GN=fdl PE=1 SV=1
Length = 660

Score = 97.8 bits (242), Expect = 2e-20
Identities = 49/119 (41%), Positives = 70/119 (58%), Gaps = 3/119 (2%)
Frame = -3

Query: 465 YAGSGGSWCAPYKTWQRIYDYDI--TYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWP 292
+ +G + CAPY+TWQ +Y + L K+ V+GGEVC+W+EQ DE LD LWP
Sbjct: 541 WRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWP 600

Query: 291 RASALAESLWSGNRDGKG-ERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGEC 118
R +ALAE LW+ D + D R+S +R +V GI+A + P +C ++PGEC
Sbjct: 601 RTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEALFPKYCAQNPGEC 659


>sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic
beta-N-acetylglucosaminidase OS=Bombyx mori PE=1 SV=1
Length = 596

Score = 88.2 bits (217), Expect = 2e-17
Identities = 44/116 (37%), Positives = 65/116 (56%)
Frame = -3

Query: 465 YAGSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRA 286
+ GSG +WC+PY Q++Y + ++GGEV LWSEQ+D LDG LWPRA
Sbjct: 485 WVGSGNNWCSPYIGGQKVYGNSPAV-MALSYRDQILGGEVALWSEQSDPATLDGRLWPRA 543

Query: 285 SALAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGEC 118
+A AE +W+ + DA +R+ R +V GI+A ++P WC ++ G C
Sbjct: 544 AAFAERMWA-----EPSTAWQDAEHRMLHVRERLVRMGIQAESLEPEWCYQNQGLC 594


>sp|P29416|HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus
musculus GN=Hexa PE=2 SV=1
Length = 528

Score = 74.3 bits (181), Expect = 2e-13
Identities = 41/97 (42%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -3

Query: 423 WQRIYDYD-ITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASALAESLWSGNRD 247
W+ +Y + + ++ T E+ LV+GGE C+W E D T L LWPRA A+AE LWS N
Sbjct: 430 WKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSSNL- 488

Query: 246 GKGERRSVD-ALYRLSDWRYHMVSRGIKAMPIQPLWC 139
++D A RLS +R +V RGI+A PI +C
Sbjct: 489 ----TTNIDFAFKRLSHFRCELVRRGIQAQPISVGYC 521


>sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo
sapiens GN=HEXB PE=1 SV=3
Length = 556

Score = 71.6 bits (174), Expect = 2e-12
Identities = 40/96 (41%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
Frame = -3

Query: 423 WQRIYDYD-ITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASALAESLWSGNRD 247
W++ Y + + + T+++ L +GGE CLW E D T L LWPRASA+ E LWS
Sbjct: 460 WRKYYKVEPLDFGGTQKQKQLFIGGEACLWGEYVDATNLTPRLWPRASAVGERLWS---- 515

Query: 246 GKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWC 139
K R DA RL+ R MV RGI A P+ +C
Sbjct: 516 SKDVRDMDDAYDRLTRHRCRMVERGIAAQPLYAGYC 551


>sp|Q641X3|HEXA_RAT Beta-hexosaminidase subunit alpha OS=Rattus
norvegicus GN=Hexa PE=2 SV=1
Length = 528

Score = 70.9 bits (172), Expect = 3e-12
Identities = 38/96 (39%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
Frame = -3

Query: 423 WQRIYDYD-ITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASALAESLWSGNRD 247
W+ +Y + + + T + LV+GGE C+W E D T L LWPRA A+AE LWS N
Sbjct: 430 WKEMYKVEPLAFRGTPAQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAIAERLWSSNLT 489

Query: 246 GKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWC 139
+ A RLS +R ++ RGI+A PI +C
Sbjct: 490 TNMD----FAFKRLSHFRCELLRRGIQAQPISVGYC 521


>sp|P20060|HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus
musculus GN=Hexb PE=2 SV=2
Length = 536

Score = 68.6 bits (166), Expect = 1e-11
Identities = 42/105 (40%), Positives = 56/105 (53%), Gaps = 1/105 (0%)
Frame = -3

Query: 423 WQRIYDYD-ITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASALAESLWSGNRD 247
W+ Y + + + ++++ LV+GGE CLW E D T L LWPRASA+ E LWS
Sbjct: 439 WKNYYKVEPLNFEGSEKQKQLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWS---- 494

Query: 246 GKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECNY 112
K +A RL+ R MVSRGI A P+ + G CNY
Sbjct: 495 PKTVTDLENAYKRLAVHRCRMVSRGIAAQPL-------YTGYCNY 532


>sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis
silvestris catus GN=HEXB PE=2 SV=2
Length = 531

Score = 68.6 bits (166), Expect = 1e-11
Identities = 42/104 (40%), Positives = 57/104 (54%), Gaps = 2/104 (1%)
Frame = -3

Query: 444 WCAPYKTWQRIYDYD-ITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASALAES 268
W + + W+ Y D + ++ ++E+ LV+GGE CLW E D T L LWPRASA+ E
Sbjct: 427 WISYGQDWRNYYKVDPLHFDGSQEQKKLVIGGEACLWGEFVDATNLTPRLWPRASAVGER 486

Query: 267 LWSGNRDGKGERRSVDALY-RLSDWRYHMVSRGIKAMPIQPLWC 139
LWS + SV Y RL+ R MV RGI A P+ +C
Sbjct: 487 LWSPE-----DITSVGNAYNRLTVHRCRMVRRGISAEPLFTGYC 525


>sp|Q5RC84|HEXA_PONAB Beta-hexosaminidase subunit alpha OS=Pongo
abelii GN=HEXA PE=3 SV=1
Length = 529

Score = 67.0 bits (162), Expect = 4e-11
Identities = 37/96 (38%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
Frame = -3

Query: 423 WQRIYDYD-ITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASALAESLWSGNRD 247
W+ Y + + + T E+ LV+GGE C+W E D T L LWPRA A+AE LWS
Sbjct: 431 WKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWS---- 486

Query: 246 GKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWC 139
K A RLS +R ++ RG++A P+ +C
Sbjct: 487 NKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFC 522


>sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo
sapiens GN=HEXA PE=1 SV=1
Length = 529

Score = 67.0 bits (162), Expect = 4e-11
Identities = 37/96 (38%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
Frame = -3

Query: 423 WQRIYDYD-ITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASALAESLWSGNRD 247
W+ Y + + + T E+ LV+GGE C+W E D T L LWPRA A+AE LWS
Sbjct: 431 WKDFYVVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWS---- 486

Query: 246 GKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWC 139
K A RLS +R ++ RG++A P+ +C
Sbjct: 487 NKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFC 522


tr_hit_id Q10PW1
Definition tr|Q10PW1|Q10PW1_ORYSJ Os03g0219400 protein OS=Oryza sativa subsp. japonica
Align length 115
Score (bit) 180.0
E-value 3.0e-44
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913896|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_E11.
(467 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q10PW1|Q10PW1_ORYSJ Os03g0219400 protein OS=Oryza sativa subs... 180 3e-44
tr|A3AFJ9|A3AFJ9_ORYSJ Putative uncharacterized protein OS=Oryza... 180 3e-44
tr|A2YJI5|A2YJI5_ORYSI Putative uncharacterized protein OS=Oryza... 180 3e-44
tr|A7QR75|A7QR75_VITVI Chromosome chr13 scaffold_149, whole geno... 179 5e-44
tr|A5AX89|A5AX89_VITVI Putative uncharacterized protein OS=Vitis... 179 5e-44
tr|B6SKN9|B6SKN9_MAIZE Beta-hexosaminidase OS=Zea mays PE=2 SV=1 179 6e-44
tr|Q6ZL33|Q6ZL33_ORYSJ Os07g0575500 protein OS=Oryza sativa subs... 177 2e-43
tr|A3BLF8|A3BLF8_ORYSJ Putative uncharacterized protein OS=Oryza... 177 2e-43
tr|A2YMX9|A2YMX9_ORYSI Putative uncharacterized protein OS=Oryza... 177 2e-43
tr|B8A2C4|B8A2C4_MAIZE Putative uncharacterized protein OS=Zea m... 176 4e-43
tr|B4FYZ2|B4FYZ2_MAIZE Beta-hexosaminidase beta chain OS=Zea may... 176 4e-43
tr|Q9SYK0|Q9SYK0_ARATH F3F20.4 protein OS=Arabidopsis thaliana G... 174 3e-42
tr|B2W8F8|B2W8F8_PYRTR Beta-hexosaminidase OS=Pyrenophora tritic... 148 2e-34
tr|Q643Y1|Q643Y1_9HYPO N-acetylglucosaminidase OS=Neotyphodium s... 146 6e-34
tr|B8MQL2|B8MQL2_9EURO Beta-N-acetylhexosaminidase NagA, putativ... 145 1e-33
tr|Q8J2T0|Q8J2T0_ASPOR Beta-N-acetylglucosaminidase (Beta-N-acet... 142 1e-32
tr|Q0U7Z6|Q0U7Z6_PHANO Putative uncharacterized protein OS=Phaeo... 142 1e-32
tr|B8MXV3|B8MXV3_ASPFL Beta-N-acetylhexosaminidase NagA, putativ... 142 1e-32
tr|Q9URR8|Q9URR8_PENCH Beta-N-acetylhexosaminidase OS=Penicilliu... 140 2e-32
tr|B6HFN5|B6HFN5_PENCH Beta-N-acetylhexosaminidase hex-Penicilli... 140 2e-32
tr|Q0PV90|Q0PV90_BEABA Putative hexosaminidase OS=Beauveria bass... 140 3e-32
tr|Q52JJ1|Q52JJ1_METAN N-acetylglucosaminidase OS=Metarhizium an... 140 4e-32
tr|B6QUM0|B6QUM0_PENMA Beta-N-acetylhexosaminidase NagA, putativ... 139 5e-32
tr|A3LVC2|A3LVC2_PICST Mannosyl-glycoprotein endo-beta-N-acetylg... 139 5e-32
tr|A2QTI6|A2QTI6_ASPNC Remark: in the literature OS=Aspergillus ... 139 5e-32
tr|Q0D1R1|Q0D1R1_ASPTN Beta-hexosaminidase OS=Aspergillus terreu... 139 9e-32
tr|A2QGF3|A2QGF3_ASPNC Putative sequencing error OS=Aspergillus ... 139 9e-32
tr|Q4WCB5|Q4WCB5_ASPFU Beta-N-acetylhexosaminidase NagA, putativ... 138 2e-31
tr|B0Y9W3|B0Y9W3_ASPFC Beta-N-acetylhexosaminidase NagA, putativ... 138 2e-31
tr|A1DBB4|A1DBB4_NEOFI Beta-N-acetylhexosaminidase NagA, putativ... 138 2e-31

>tr|Q10PW1|Q10PW1_ORYSJ Os03g0219400 protein OS=Oryza sativa subsp.
japonica GN=Os03g0219400 PE=2 SV=1
Length = 605

Score = 180 bits (457), Expect = 3e-44
Identities = 78/115 (67%), Positives = 94/115 (81%)
Frame = -3

Query: 459 GSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASA 280
G+GGSWCAP+KTWQR+YDYDI + LT +EA LV+GGEV LWSEQ+DETVLD LWPRA+A
Sbjct: 488 GTGGSWCAPFKTWQRVYDYDILHGLTDDEAQLVLGGEVALWSEQSDETVLDARLWPRAAA 547

Query: 279 LAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
AE+LWSGN+ G++R +A RL+DWR+ MV RGI+A PIQPLWC HPG CN
Sbjct: 548 AAETLWSGNKGSNGKKRYANATDRLNDWRHRMVERGIRAEPIQPLWCSLHPGMCN 602


>tr|A3AFJ9|A3AFJ9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009571 PE=4 SV=1
Length = 617

Score = 180 bits (457), Expect = 3e-44
Identities = 78/115 (67%), Positives = 94/115 (81%)
Frame = -3

Query: 459 GSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASA 280
G+GGSWCAP+KTWQR+YDYDI + LT +EA LV+GGEV LWSEQ+DETVLD LWPRA+A
Sbjct: 500 GTGGSWCAPFKTWQRVYDYDILHGLTDDEAQLVLGGEVALWSEQSDETVLDARLWPRAAA 559

Query: 279 LAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
AE+LWSGN+ G++R +A RL+DWR+ MV RGI+A PIQPLWC HPG CN
Sbjct: 560 AAETLWSGNKGSNGKKRYANATDRLNDWRHRMVERGIRAEPIQPLWCSLHPGMCN 614


>tr|A2YJI5|A2YJI5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25394 PE=4 SV=1
Length = 400

Score = 180 bits (457), Expect = 3e-44
Identities = 78/115 (67%), Positives = 94/115 (81%)
Frame = -3

Query: 459 GSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASA 280
G+GGSWCAP+KTWQR+YDYDI + LT +EA LV+GGEV LWSEQ+DETVLD LWPRA+A
Sbjct: 283 GTGGSWCAPFKTWQRVYDYDILHGLTDDEAQLVLGGEVALWSEQSDETVLDARLWPRAAA 342

Query: 279 LAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
AE+LWSGN+ G++R +A RL+DWR+ MV RGI+A PIQPLWC HPG CN
Sbjct: 343 AAETLWSGNKGSNGKKRYANATDRLNDWRHRMVERGIRAEPIQPLWCSLHPGMCN 397


>tr|A7QR75|A7QR75_VITVI Chromosome chr13 scaffold_149, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00003707001
PE=4 SV=1
Length = 565

Score = 179 bits (455), Expect = 5e-44
Identities = 78/114 (68%), Positives = 95/114 (83%)
Frame = -3

Query: 456 SGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASAL 277
+GGSWC P+KTWQ IY+YDITY L+ EEA LV+GGEV LWSEQAD TVLD +WPRASA+
Sbjct: 446 NGGSWCGPFKTWQTIYNYDITYGLSDEEAKLVLGGEVALWSEQADPTVLDARIWPRASAM 505

Query: 276 AESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
AE+LWSGN+D G +R DA+ RL++WRY MV+RGI A PIQPLWC+++PG CN
Sbjct: 506 AEALWSGNQDKTGMKRYADAMDRLNEWRYRMVARGIGAEPIQPLWCIRNPGMCN 559


>tr|A5AX89|A5AX89_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034316 PE=4 SV=1
Length = 558

Score = 179 bits (455), Expect = 5e-44
Identities = 78/114 (68%), Positives = 95/114 (83%)
Frame = -3

Query: 456 SGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASAL 277
+GGSWC P+KTWQ IY+YDITY L+ EEA LV+GGEV LWSEQAD TVLD +WPRASA+
Sbjct: 439 NGGSWCGPFKTWQTIYNYDITYGLSDEEAKLVLGGEVALWSEQADPTVLDARIWPRASAM 498

Query: 276 AESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
AE+LWSGN+D G +R DA+ RL++WRY MV+RGI A PIQPLWC+++PG CN
Sbjct: 499 AEALWSGNQDKTGMKRYADAMDRLNEWRYRMVARGIGAEPIQPLWCIRNPGMCN 552


>tr|B6SKN9|B6SKN9_MAIZE Beta-hexosaminidase OS=Zea mays PE=2 SV=1
Length = 578

Score = 179 bits (454), Expect = 6e-44
Identities = 77/117 (65%), Positives = 90/117 (76%)
Frame = -3

Query: 465 YAGSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRA 286
+ +GGSWC PYKTWQR+YDYDI Y LT EEA LV+GGEV +W+EQ D TVLDG +WPRA
Sbjct: 459 FDANGGSWCGPYKTWQRVYDYDIAYGLTPEEAQLVLGGEVAMWTEQVDTTVLDGRVWPRA 518

Query: 285 SALAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
SA+AE+LWSGNRD G +R +A RL DWR MV RG++A PIQPLWC PG CN
Sbjct: 519 SAMAEALWSGNRDASGRKRYAEATDRLIDWRQRMVGRGVRAEPIQPLWCRTRPGMCN 575


>tr|Q6ZL33|Q6ZL33_ORYSJ Os07g0575500 protein OS=Oryza sativa subsp.
japonica GN=OJ1699_E05.49 PE=4 SV=1
Length = 593

Score = 177 bits (450), Expect = 2e-43
Identities = 76/117 (64%), Positives = 90/117 (76%)
Frame = -3

Query: 465 YAGSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRA 286
Y SGGSWC PYKTWQR+YDYD+ LT EEA LV+GGEV +W+EQ D VLDG +WPRA
Sbjct: 474 YGTSGGSWCGPYKTWQRVYDYDVAGGLTAEEARLVVGGEVAMWTEQVDAAVLDGRVWPRA 533

Query: 285 SALAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
SA+AE+LWSGNRD G +R +A RL+DWR+ MV RG++A PIQPLWC PG CN
Sbjct: 534 SAMAEALWSGNRDATGRKRYAEATDRLTDWRHRMVGRGVRAEPIQPLWCRNRPGMCN 590


>tr|A3BLF8|A3BLF8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_023880 PE=4 SV=1
Length = 579

Score = 177 bits (450), Expect = 2e-43
Identities = 76/117 (64%), Positives = 90/117 (76%)
Frame = -3

Query: 465 YAGSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRA 286
Y SGGSWC PYKTWQR+YDYD+ LT EEA LV+GGEV +W+EQ D VLDG +WPRA
Sbjct: 460 YGTSGGSWCGPYKTWQRVYDYDVAGGLTAEEARLVVGGEVAMWTEQVDAAVLDGRVWPRA 519

Query: 285 SALAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
SA+AE+LWSGNRD G +R +A RL+DWR+ MV RG++A PIQPLWC PG CN
Sbjct: 520 SAMAEALWSGNRDATGRKRYAEATDRLTDWRHRMVGRGVRAEPIQPLWCRNRPGMCN 576


>tr|A2YMX9|A2YMX9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26587 PE=4 SV=1
Length = 593

Score = 177 bits (450), Expect = 2e-43
Identities = 76/117 (64%), Positives = 90/117 (76%)
Frame = -3

Query: 465 YAGSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRA 286
Y SGGSWC PYKTWQR+YDYD+ LT EEA LV+GGEV +W+EQ D VLDG +WPRA
Sbjct: 474 YGTSGGSWCGPYKTWQRVYDYDVAGGLTAEEARLVVGGEVAMWTEQVDAAVLDGRVWPRA 533

Query: 285 SALAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
SA+AE+LWSGNRD G +R +A RL+DWR+ MV RG++A PIQPLWC PG CN
Sbjct: 534 SAMAEALWSGNRDATGRKRYAEATDRLTDWRHRMVGRGVRAEPIQPLWCRNRPGMCN 590


>tr|B8A2C4|B8A2C4_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 599

Score = 176 bits (447), Expect = 4e-43
Identities = 77/115 (66%), Positives = 92/115 (80%)
Frame = -3

Query: 459 GSGGSWCAPYKTWQRIYDYDITYNLTKEEAGLVMGGEVCLWSEQADETVLDGLLWPRASA 280
G+GGSWCAP+KTWQRIYDYDI + LT++EA V+GGEV LWSEQ+D VLDG LWPRASA
Sbjct: 482 GTGGSWCAPFKTWQRIYDYDILHGLTEDEARRVLGGEVALWSEQSDAAVLDGRLWPRASA 541

Query: 279 LAESLWSGNRDGKGERRSVDALYRLSDWRYHMVSRGIKAMPIQPLWCLKHPGECN 115
AE+LWSGN+ G +R +A RL++WRY MV+RGI+A PIQPLWC HP CN
Sbjct: 542 AAETLWSGNKGSNGRKRYANATVRLNEWRYRMVARGIRAEPIQPLWCPMHPRMCN 596