BP913897
Clone id YMU001_000037_E12
Library
Length 573
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGCAGAAATATGTGATTTCATTAATTTGGAAATGGCCAAAGCCGATACAAGGGGAACAA
ACTCTCCTTTGAGCCTGACATCAATTACAATTTCGTTGCCTTTGGAATTCTTCAAAGTAA
ATTTTCTGGTTCCACAATCTATAACCACTTTATTCTTGTCCAAGCCATGGCATCCCTAAG
AGAACATCACACCCCTCAAGTGGCATGATGTAAAAATCCTCCTGGCCGACATATTGCTGA
CAATGCAAGCGAAGCTTGCCAATCAACGGTGTCACTGCAATCTCATGTCTTTTGGCCGCC
AAAGCTGCATCAACCTGTGGTCCCATCTCTTTGGGCTTGACTCCCAGACGTGCCGCCATC
TTTGGAGAAATGAAGTTGGCCTTGGCACCACTGTCGAAGAAAATCAAAGCCTCCTGATCT
CGTAGTTTTCCCCAAGCTCTGCATAGCTCAGAGCCTCTGTCCTCCGCTTCTGGCACTATC
CCAATCATATCCGGAATCAAACCAGCCTTTGTCTTTCCCTTCCTAGCATGTCACTCCTCT
GCTGCTCTCGAGGACTCAGATCTATCTTCAGTA
■■Homology search results ■■ -
sp_hit_id Q27J49
Definition sp|Q27J49|BNP_LACMU Bradykinin-potentiating and C-type natriuretic peptides OS=Lachesis muta muta
Align length 62
Score (bit) 30.8
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913897|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_E12.
(573 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q27J49|BNP_LACMU Bradykinin-potentiating and C-type natriuret... 31 1.2
sp|O95644|NFAC1_HUMAN Nuclear factor of activated T-cells, cytop... 31 3.9
sp|Q1H0M1|TRPB_METFK Tryptophan synthase beta chain OS=Methyloba... 31 5.0
sp|A2A8T7|CA223_MOUSE Uncharacterized protein C1orf223 homolog O... 31 5.0
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SE... 30 6.5

>sp|Q27J49|BNP_LACMU Bradykinin-potentiating and C-type natriuretic
peptides OS=Lachesis muta muta PE=1 SV=1
Length = 239

Score = 30.8 bits (68), Expect(2) = 1.2
Identities = 22/62 (35%), Positives = 25/62 (40%), Gaps = 1/62 (1%)
Frame = +2

Query: 185 HHTPQVA*CKNPPGRHIADNASEACQSTVSLQSHVFWPPKLH-QPVVPSLWA*LPDVPPS 361
HH P V + PPG HI V S WPP H P+V W P PP
Sbjct: 57 HHIPPVVVQEWPPGHHIP-------PLVVQQWSQKKWPPGHHIPPLVVQKWDPPPISPPL 109

Query: 362 LE 367
L+
Sbjct: 110 LK 111



Score = 20.8 bits (42), Expect(2) = 1.2
Identities = 7/23 (30%), Positives = 12/23 (52%)
Frame = +3

Query: 129 VPQSITTLFLSKPWHP*ENITPL 197
+P + + KPW P +I P+
Sbjct: 40 IPPLVVQQWSQKPWPPGHHIPPV 62


>sp|O95644|NFAC1_HUMAN Nuclear factor of activated T-cells,
cytoplasmic 1 OS=Homo sapiens GN=NFATC1 PE=1 SV=3
Length = 943

Score = 31.2 bits (69), Expect = 3.9
Identities = 20/67 (29%), Positives = 31/67 (46%)
Frame = +1

Query: 307 ASTCGPISLGLTPRRAAIFGEMKLALAPLSKKIKAS*SRSFPQALHSSEPLSSASGTIPI 486
A TCGP+S GL+P + + +LA+ P + FP S + +A G P
Sbjct: 712 APTCGPVSQGLSPLPRPYYSQ-QLAMPPDPSSCLVA---GFPPCPQRSTLMPAAPGVSPK 767

Query: 487 ISGIKPA 507
+ + PA
Sbjct: 768 LHDLSPA 774


>sp|Q1H0M1|TRPB_METFK Tryptophan synthase beta chain
OS=Methylobacillus flagellatus (strain KT / ATCC 51484 /
DSM 6875) GN=trpB PE=3 SV=1
Length = 400

Score = 30.8 bits (68), Expect = 5.0
Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
Frame = -2

Query: 332 KEMG-PQVDAALAAKRHEIAVTPLIGKLRLHCQQYVGQED 216
K MG P+V A A +H +A + +L L C Y+G ED
Sbjct: 104 KRMGKPRVIAETGAGQHGVATATIAARLGLECVVYMGAED 143


>sp|A2A8T7|CA223_MOUSE Uncharacterized protein C1orf223 homolog
OS=Mus musculus PE=2 SV=1
Length = 201

Score = 30.8 bits (68), Expect = 5.0
Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 2/39 (5%)
Frame = +2

Query: 398 RKSKPPDLVVFPKLCIAQSLC--PPLLALSQSYPESNQP 508
R P L +F ++ A SLC PP+L S SYP +N+P
Sbjct: 135 RTDSPFPLPIFQEVPFALSLCHLPPMLNHSVSYPLANRP 173


>sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens
GN=SEC14L1 PE=2 SV=1
Length = 715

Score = 30.4 bits (67), Expect = 6.5
Identities = 19/50 (38%), Positives = 26/50 (52%)
Frame = +3

Query: 219 LLADILLTMQAKLANQRCHCNLMSFGRQSCINLWSHLFGLDSQTCRHLWR 368
LL +L + +L +RC N FGR I+ W+ L L+ RHLWR
Sbjct: 363 LLRYVLSVNEERL--RRCEENTKVFGRP--ISSWTCLVDLEGLNMRHLWR 408


tr_hit_id B8B5X3
Definition tr|B8B5X3|B8B5X3_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 99
Score (bit) 52.0
E-value 2.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913897|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_E12.
(573 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8B5X3|B8B5X3_ORYSI Putative uncharacterized protein OS=Oryza... 52 2e-05
tr|Q2R2N6|Q2R2N6_ORYSJ Retrotransposon protein, putative, unclas... 51 5e-05
tr|Q0IQH3|Q0IQH3_ORYSJ Os12g0121200 protein (Fragment) OS=Oryza ... 50 7e-05
tr|A5X2S4|A5X2S4_9ERIC Polyprotein OS=Primula vulgaris PE=4 SV=1 50 7e-05
tr|A7QWB9|A7QWB9_VITVI Chromosome chr6 scaffold_202, whole genom... 50 9e-05
tr|Q9LHM4|Q9LHM4_ARATH Retroelement pol polyprotein (Gypsy/Ty-3 ... 48 3e-04
tr|Q0JKY7|Q0JKY7_ORYSJ Os01g0640000 protein OS=Oryza sativa subs... 48 3e-04
tr|Q53P05|Q53P05_ORYSJ Retrotransposon protein, putative, unclas... 47 6e-04
tr|Q2QRI2|Q2QRI2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 33 0.001
tr|Q6F2Q6|Q6F2Q6_ORYSJ Putative polyprotein OS=Oryza sativa subs... 33 0.001
tr|Q7XQU9|Q7XQU9_ORYSJ OSJNBa0086B14.15 protein OS=Oryza sativa ... 33 0.002
tr|Q5JQX2|Q5JQX2_ORYSA OSJNBb0015D13.7 protein OS=Oryza sativa G... 33 0.002
tr|Q2QT71|Q2QT71_ORYSJ Retrotransposon protein, putative, Ty3-gy... 33 0.002
tr|Q01M17|Q01M17_ORYSA OSIGBa0148D14.4 protein OS=Oryza sativa G... 33 0.002
tr|Q5W677|Q5W677_ORYSJ Putative polyprotein OS=Oryza sativa subs... 33 0.002
tr|Q6ATE0|Q6ATE0_ORYSJ Putative polyprotein OS=Oryza sativa subs... 33 0.002
tr|Q25AE1|Q25AE1_ORYSA H0201G08.12 protein OS=Oryza sativa GN=H0... 33 0.002
tr|Q7X798|Q7X798_ORYSJ OSJNBb0108J11.19 protein (OSJNBa0028I23.1... 33 0.002
tr|Q7XQE2|Q7XQE2_ORYSJ OSJNBa0070O11.7 protein OS=Oryza sativa s... 33 0.002
tr|Q6AT86|Q6AT86_ORYSJ Putative polyprotein OS=Oryza sativa subs... 32 0.002
tr|Q10NS5|Q10NS5_ORYSJ Retrotransposon protein, putative, Ty3-gy... 33 0.002
tr|Q2R082|Q2R082_ORYSJ Retrotransposon protein, putative, Ty3-gy... 33 0.002
tr|A5AJD0|A5AJD0_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|Q9C7H8|Q9C7H8_ARATH Gypsy/Ty3 element polyprotein, putative O... 45 0.003
tr|Q7XW39|Q7XW39_ORYSJ OSJNBb0062H02.17 protein (OSJNBa0054D14.1... 45 0.003
tr|Q7XCD6|Q7XCD6_ORYSJ Retrotransposon protein, putative, unclas... 45 0.004
tr|Q0IVV4|Q0IVV4_ORYSJ Os10g0551400 protein OS=Oryza sativa subs... 45 0.004
tr|B5U9W4|B5U9W4_LOTJA Putative uncharacterized protein OS=Lotus... 45 0.004
tr|B5U9W1|B5U9W1_LOTJA Putative uncharacterized protein OS=Lotus... 45 0.004
tr|B5U9W0|B5U9W0_LOTJA Putative uncharacterized protein OS=Lotus... 45 0.004

>tr|B8B5X3|B8B5X3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25921 PE=4 SV=1
Length = 426

Score = 52.0 bits (123), Expect = 2e-05
Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
Frame = -2

Query: 455 GSELCRAWGKLRDQEALIFFDSGAKANFISPKMAARLGVKPKEMGP-QVDAALAAKRHEI 279
G R G L++QE L+ DSG+ +NF+S ++ ++L + + P QV A K I
Sbjct: 227 GKRTIRLQGLLQNQEILVLVDSGSFSNFLSEQLVSKLQLPTQTSAPSQVTIADGGK---I 283

Query: 278 AVTPLIGKLRLHCQQYVGQEDFYIMPLEGCDVLLGMPWL 162
++ L CQ + D ++ L D++LGM WL
Sbjct: 284 LCNQVVANLEWWCQGHTFSTDLKVLSLGSYDMILGMEWL 322


>tr|Q2R2N6|Q2R2N6_ORYSJ Retrotransposon protein, putative,
unclassified OS=Oryza sativa subsp. japonica
GN=LOC_Os11g35200 PE=4 SV=1
Length = 1369

Score = 50.8 bits (120), Expect = 5e-05
Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
Frame = -2

Query: 467 AEDRGSELCRAWGKLRDQEALIFFDSGAKANFISPKMAARL-GVKPKEMGPQVDAALAAK 291
+E RGS R G+++ +E LI DSG+ A+FIS K+AA L GV+ QV A A
Sbjct: 359 SEHRGS--MRMLGQIQGKEILILVDSGSTASFISKKLAAGLVGVQGLPTKVQVKVADGAV 416

Query: 290 RHEIAVTPLIGKLRLHCQQYVGQEDFYIMPLEGCDVLLGMPWLGQ 156
H +I Q ++ DF ++ L DV+LGM WL Q
Sbjct: 417 LH---CQSVIQNCEWVSQGHMFCTDFKVLALGNYDVILGMDWLMQ 458


>tr|Q0IQH3|Q0IQH3_ORYSJ Os12g0121200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os12g0121200 PE=4 SV=1
Length = 461

Score = 50.4 bits (119), Expect = 7e-05
Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 3/107 (2%)
Frame = -2

Query: 440 RAWGKLRDQEALIFFDSGAKANFISPKMAARLGVKPKEMGPQVDAALAAKRHEIAVTPLI 261
+ W +L QE + DSG+ NFI+ +A + GV P + P + A+A P
Sbjct: 3 KVWARLGSQELVALLDSGSTHNFINDAIAHQAGV-PLQRRPGLSVAVANGDR----VPSP 57

Query: 260 GKL---RLHCQQYVGQEDFYIMPLEGCDVLLGMPWLGQE*SGYRLWN 129
G+ R+ + DFY +PL G D++LG WLG G LW+
Sbjct: 58 GRCPPQRVSIGSHEFDIDFYALPLGGYDIVLGAQWLGT--LGPTLWD 102


>tr|A5X2S4|A5X2S4_9ERIC Polyprotein OS=Primula vulgaris PE=4 SV=1
Length = 1359

Score = 50.4 bits (119), Expect = 7e-05
Identities = 31/92 (33%), Positives = 47/92 (51%)
Frame = -2

Query: 431 GKLRDQEALIFFDSGAKANFISPKMAARLGVKPKEMGPQVDAALAAKRHEIAVTPLIGKL 252
GKL+ Q+ I DSG+ NFI PK L K + + A +I + K+
Sbjct: 295 GKLKGQKVSILVDSGSTHNFIDPKWVPLL--KLSNVQSDIMEVKIANGDKIKSSGTCEKV 352

Query: 251 RLHCQQYVGQEDFYIMPLEGCDVLLGMPWLGQ 156
+L Q+ + DF ++PL G D++LG+ WL Q
Sbjct: 353 KLLIQENQFEVDFLLLPLVGYDLVLGVHWLSQ 384


>tr|A7QWB9|A7QWB9_VITVI Chromosome chr6 scaffold_202, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00008595001
PE=4 SV=1
Length = 150

Score = 50.1 bits (118), Expect = 9e-05
Identities = 26/82 (31%), Positives = 47/82 (57%)
Frame = -2

Query: 404 IFFDSGAKANFISPKMAARLGVKPKEMGPQVDAALAAKRHEIAVTPLIGKLRLHCQQYVG 225
I DSG+ NF+ K+A +G+K + + + + + ++ +++L Q
Sbjct: 70 ILIDSGSTHNFLHHKIAKIIGLKSERSC--LFSMVVSNGERLSSPRRCNEVKLSLQGIPI 127

Query: 224 QEDFYIMPLEGCDVLLGMPWLG 159
+ DF+++PLEGCDV+LG+ WLG
Sbjct: 128 KVDFFLLPLEGCDVVLGVQWLG 149


>tr|Q9LHM4|Q9LHM4_ARATH Retroelement pol polyprotein (Gypsy/Ty-3
retroelement polyprotein; 69905-74404) OS=Arabidopsis
thaliana GN=T21B14.24 PE=4 SV=1
Length = 1499

Score = 48.1 bits (113), Expect = 3e-04
Identities = 36/100 (36%), Positives = 48/100 (48%), Gaps = 2/100 (2%)
Frame = -2

Query: 455 GSELCRAWGKLRDQEALIFFDSGAKANFISPKMAARLGVKPKEMG-PQVDAALAAK-RHE 282
G + R G + I DSG+ NF+ P AA+LG K G +V A K R E
Sbjct: 386 GYKTMRVKGTYDKKIIFILIDSGSTHNFLDPNTAAKLGCKVDTAGLTRVSVADGRKLRVE 445

Query: 281 IAVTPLIGKLRLHCQQYVGQEDFYIMPLEGCDVLLGMPWL 162
VT KL Q Q D ++PL+G D++LG+ WL
Sbjct: 446 GKVTDFSWKL----QTTTFQSDILLIPLQGIDMVLGVQWL 481


>tr|Q0JKY7|Q0JKY7_ORYSJ Os01g0640000 protein OS=Oryza sativa subsp.
japonica GN=Os01g0640000 PE=4 SV=1
Length = 1660

Score = 48.1 bits (113), Expect = 3e-04
Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 3/107 (2%)
Frame = -2

Query: 440 RAWGKLRDQEALIFFDSGAKANFISPKMAARLGVKPKEMGPQVDAALAAKRHEIAVTPLI 261
+ W +L QE + DSG+ NFI+ +A + V P + P + A+A P
Sbjct: 514 KVWARLGSQELVALLDSGSTHNFINDAIAHQASV-PLQRRPGLSVAVANGDR----VPSP 568

Query: 260 GKL---RLHCQQYVGQEDFYIMPLEGCDVLLGMPWLGQE*SGYRLWN 129
G+ R+ + DFY +PL G D++LG WLG G LW+
Sbjct: 569 GRCPPQRVSIGSHEFDIDFYALPLGGYDIVLGAQWLGT--LGPTLWD 613


>tr|Q53P05|Q53P05_ORYSJ Retrotransposon protein, putative,
unclassified OS=Oryza sativa subsp. japonica PE=4 SV=1
Length = 1126

Score = 47.4 bits (111), Expect = 6e-04
Identities = 28/98 (28%), Positives = 46/98 (46%)
Frame = -2

Query: 455 GSELCRAWGKLRDQEALIFFDSGAKANFISPKMAARLGVKPKEMGPQVDAALAAKRHEIA 276
G R G +++QE LI DSG+ ++F++ + L + E P + A +
Sbjct: 439 GKRTVRLQGLIQNQEVLILIDSGSSSSFVAQHLVDSLSLAVLETAPA--QVVIADGGVLQ 496

Query: 275 VTPLIGKLRLHCQQYVGQEDFYIMPLEGCDVLLGMPWL 162
+ K+ CQ + D ++ L G DV+LGM WL
Sbjct: 497 CNKVATKVDWWCQGHSFTSDLKVLQLGGYDVILGMDWL 534


>tr|Q2QRI2|Q2QRI2_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os12g27490 PE=4 SV=1
Length = 1611

Score = 33.1 bits (74), Expect(2) = 0.001
Identities = 15/29 (51%), Positives = 18/29 (62%)
Frame = -3

Query: 175 GCHGLDKNKVVIDCGTRKFTLKNSKGNEI 89
G L +NK VIDC +R TL N KG +I
Sbjct: 593 GMDWLTRNKGVIDCASRTITLNNDKGEKI 621



Score = 32.7 bits (73), Expect(2) = 0.001
Identities = 19/83 (22%), Positives = 40/83 (48%)
Frame = -2

Query: 410 ALIFFDSGAKANFISPKMAARLGVKPKEMGPQVDAALAAKRHEIAVTPLIGKLRLHCQQY 231
A + FDSGA +FIS + A G+ E+ ++ + +++ + + + ++
Sbjct: 517 ATVLFDSGASHSFISKRFAGTHGLSVVEL--KIPMQVHTPGNDMRTSHYCPSVTIEIKRS 574

Query: 230 VGQEDFYIMPLEGCDVLLGMPWL 162
+ ++ + DV+LGM WL
Sbjct: 575 PFLSNLILLESKDLDVILGMDWL 597


>tr|Q6F2Q6|Q6F2Q6_ORYSJ Putative polyprotein OS=Oryza sativa subsp.
japonica GN=OSJNBa0088M06.2 PE=4 SV=1
Length = 1516

Score = 33.1 bits (74), Expect(2) = 0.001
Identities = 18/48 (37%), Positives = 25/48 (52%)
Frame = -3

Query: 175 GCHGLDKNKVVIDCGTRKFTLKNSKGNEIVIDVRLKGEFVPLVSALAI 32
G L +NK VIDC +R TL N KG +I + + V ++ AI
Sbjct: 480 GMDWLTRNKGVIDCASRTITLTNDKGEKITFRSPVSQKSVASLNQAAI 527



Score = 32.3 bits (72), Expect(2) = 0.001
Identities = 19/83 (22%), Positives = 39/83 (46%)
Frame = -2

Query: 410 ALIFFDSGAKANFISPKMAARLGVKPKEMGPQVDAALAAKRHEIAVTPLIGKLRLHCQQY 231
A + FDSGA +FIS + A G+ E+ ++ + +++ + + ++
Sbjct: 404 ATVLFDSGASHSFISKRFAGMHGLSVVEL--KIPMQVHTPGNDMRTAHYCPSVTIEIKRS 461

Query: 230 VGQEDFYIMPLEGCDVLLGMPWL 162
+ ++ + DV+LGM WL
Sbjct: 462 PFLSNLILLESKDLDVILGMDWL 484