BP913908
Clone id YMU001_000037_F11
Library
Length 505
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGACAGATCAGCTGTGAGATTCAAAGGTAATTGTGCCACTGCTGTGTCAAATGAAGGACA
GGATGTGAAACAAGAAGAAAGGCATTCACCTGTGAGACCTGTCTTAGTGGAAAAGGAGGT
GGTAAAACCAAGTCGGCAGAGGCCTTTTCACGATAACCTGCCAATTTCTGATAAAGGAGC
TGGAAAGCTGATACAACATCTAAGTTTACCAGAAAATCAATGCATAGGAGGAGAGTCCAG
CATGCAGTCGAGAAAGCAGGGCGAGAATGATCATTTTGTATGGGTGAATCGCAGAAGGTA
TCAAAAGCTGAAAAAATTGGGAGAGGTGGCAGCAGTGAAGTTTTTAAGGTGATTGATAGG
GATGGCAACATTTATGCCCTCAAACGTATTAAGTTAAAGGGTCGTGACTATGCTACGGCT
TATGGGTTTTATCAAGAGATCGAGCTTCTTACCAAGCTACAGGGAAAAAGCTATATTATT
CGTCCCATTAATCATGAGGTAACAG
■■Homology search results ■■ -
sp_hit_id P54199
Definition sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae
Align length 66
Score (bit) 55.1
E-value 2.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913908|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_F11.
(505 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Sac... 55 2e-07
sp|P33981|TTK_HUMAN Dual specificity protein kinase TTK OS=Homo ... 49 2e-05
sp|Q4R945|TTK_MACFA Dual specificity protein kinase TTK OS=Macac... 48 2e-05
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio... 47 7e-05
sp|O94235|MPH1_SCHPO Serine/threonine-protein kinase mph1 OS=Sch... 47 7e-05
sp|Q54UL8|MPS1_DICDI Probable serine/threonine-protein kinase mp... 44 4e-04
sp|P51166|CDK5_XENLA Cell division protein kinase 5 OS=Xenopus l... 41 0.004
sp|P34117|CDK5_DICDI Cell division protein kinase 5 homolog OS=D... 40 0.008
sp|Q4R8E0|E2AK1_MACFA Eukaryotic translation initiation factor 2... 39 0.011
sp|Q9LMB9|CRK1_ARATH Cysteine-rich receptor-like protein kinase ... 39 0.011
sp|Q03114|CDK5_RAT Cell division protein kinase 5 OS=Rattus norv... 39 0.011
sp|P49615|CDK5_MOUSE Cell division protein kinase 5 OS=Mus muscu... 39 0.011
sp|Q00535|CDK5_HUMAN Cell division protein kinase 5 OS=Homo sapi... 39 0.011
sp|Q02399|CDK5_BOVIN Cell division protein kinase 5 OS=Bos tauru... 39 0.011
sp|P48609|CDK5_DROME Cell division protein kinase 5 homolog OS=D... 39 0.014
sp|Q38774|CDC2C_ANTMA Cell division control protein 2 homolog C ... 39 0.018
sp|Q9LZM4|WAKLQ_ARATH Putative wall-associated receptor kinase-l... 38 0.031
sp|Q9CAL3|CRK2_ARATH Cysteine-rich receptor-like protein kinase ... 38 0.031
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sati... 37 0.040
sp|Q2PQN9|CDK5_GLOMM Cell division protein kinase 5 homolog OS=G... 37 0.040
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS... 37 0.040
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS... 37 0.040
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsi... 37 0.053
sp|Q9BQI3|E2AK1_HUMAN Eukaryotic translation initiation factor 2... 37 0.069
sp|P25859|CKB11_ARATH Cyclin-dependent kinase B1-1 OS=Arabidopsi... 37 0.069
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 ... 37 0.069
sp|P33279|E2AK1_RABIT Eukaryotic translation initiation factor 2... 36 0.090
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=... 36 0.090
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS... 36 0.090
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS... 36 0.090

>sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1
OS=Saccharomyces cerevisiae GN=MPS1 PE=1 SV=1
Length = 764

Score = 55.1 bits (131), Expect = 2e-07
Identities = 28/66 (42%), Positives = 42/66 (63%)
Frame = +1

Query: 304 KAEKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIR 483
K E +GRGGSS V+KV +YALKR+ D ++ GF EIELL KL+ + +I+
Sbjct: 442 KIELLGRGGSSRVYKVKGSGNRVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDQKRVIQ 501

Query: 484 PINHEV 501
+++E+
Sbjct: 502 LLDYEM 507


>sp|P33981|TTK_HUMAN Dual specificity protein kinase TTK OS=Homo
sapiens GN=TTK PE=1 SV=2
Length = 857

Score = 48.5 bits (114), Expect = 2e-05
Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
Frame = +1

Query: 310 EKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKS-YIIRP 486
++IG GGSS+VF+V++ IYA+K + L+ D T + EI L KLQ S IIR
Sbjct: 529 KQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRL 588

Query: 487 INHEVT 504
++E+T
Sbjct: 589 YDYEIT 594


>sp|Q4R945|TTK_MACFA Dual specificity protein kinase TTK OS=Macaca
fascicularis GN=TTK PE=2 SV=1
Length = 856

Score = 48.1 bits (113), Expect = 2e-05
Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
Frame = +1

Query: 310 EKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKS-YIIRP 486
++IG GGSS+VF+V++ IYA+K + L+ D T + EI L KLQ S IIR
Sbjct: 528 KQIGSGGSSKVFQVLNEKKQIYAIKFVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRL 587

Query: 487 INHEVT 504
++E+T
Sbjct: 588 YDYEIT 593


>sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio
rerio GN=ttk PE=1 SV=2
Length = 982

Score = 46.6 bits (109), Expect = 7e-05
Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
Frame = +1

Query: 316 IGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKS-YIIRPIN 492
IGRGGSS+V++V D ++YA+K + L+ D + EIE L LQ S II+ +
Sbjct: 659 IGRGGSSKVYQVFDHKKHVYAVKYVNLEEADAQAVESYKNEIEHLNHLQQYSDQIIKLYD 718

Query: 493 HEVT 504
+E+T
Sbjct: 719 YEIT 722


>sp|O94235|MPH1_SCHPO Serine/threonine-protein kinase mph1
OS=Schizosaccharomyces pombe GN=mph1 PE=2 SV=1
Length = 678

Score = 46.6 bits (109), Expect = 7e-05
Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
Frame = +1

Query: 316 IGRGGSSEVFKVIDRDGN-IYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIRPIN 492
+G+GGSS V+++ D + +YALK + D T G+ EI LL KL G II+
Sbjct: 322 VGKGGSSMVYRIFSPDNSRLYALKEVNFINADQTTIQGYKNEIALLRKLSGNDRIIKLYA 381

Query: 493 HEV 501
EV
Sbjct: 382 AEV 384


>sp|Q54UL8|MPS1_DICDI Probable serine/threonine-protein kinase mps1
OS=Dictyostelium discoideum GN=mps1 PE=3 SV=1
Length = 983

Score = 43.9 bits (102), Expect = 4e-04
Identities = 27/66 (40%), Positives = 41/66 (62%)
Frame = +1

Query: 304 KAEKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIR 483
+ E IG+GGS +V+KV+ D IYALK + L + A EIE+L +L+ + II+
Sbjct: 716 RIEFIGKGGSGKVYKVLSGDLKIYALKYVCLSDPNEIEAQ--LNEIEMLKRLRKQVNIIQ 773

Query: 484 PINHEV 501
I++EV
Sbjct: 774 LIDYEV 779


>sp|P51166|CDK5_XENLA Cell division protein kinase 5 OS=Xenopus
laevis GN=cdk5 PE=2 SV=1
Length = 292

Score = 40.8 bits (94), Expect = 0.004
Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
Frame = +1

Query: 292 QKVSKAEKIGRGGSSEVFKVIDRDGN-IYALKRIKLKGRDYATAYGFYQEIELLTKLQGK 468
QK K EKIG G VFK +RD + I ALKR++L D +EI LL +L+ K
Sbjct: 2 QKYEKLEKIGEGTYGTVFKAKNRDTHEIVALKRVRLDDDDEGVPSSALREICLLKELKHK 61

Query: 469 SYI 477
+ +
Sbjct: 62 NIV 64


>sp|P34117|CDK5_DICDI Cell division protein kinase 5 homolog
OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2
Length = 292

Score = 39.7 bits (91), Expect = 0.008
Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
Frame = +1

Query: 292 QKVSKAEKIGRGGSSEVFKVIDRD-GNIYALKRIKLKGRDYATAYGFYQEIELLTKLQ 462
+K SK EK+G G V+K +R+ G I ALKRI+L D +EI LL +L+
Sbjct: 2 EKYSKIEKLGEGTYGIVYKAKNRETGEIVALKRIRLDSEDEGVPCTAIREISLLKELK 59


>sp|Q4R8E0|E2AK1_MACFA Eukaryotic translation initiation factor
2-alpha kinase 1 OS=Macaca fascicularis GN=EIF2AK1 PE=2
SV=1
Length = 631

Score = 39.3 bits (90), Expect = 0.011
Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
Frame = +1

Query: 235 VQHAVEKAGRE*SFCMGESQKVSKAEKI---GRGGSSEVFKVIDR-DGNIYALKRIKLKG 402
V H + RE +F S+ +++ E++ G+GG V+KV ++ DG YA+K+I +KG
Sbjct: 143 VSHIQKIRSREVAFEAQTSRYLNEFEEVAILGKGGYGRVYKVRNKLDGQYYAIKKILIKG 202

Query: 403 RDYATAYGFYQEIELLTKLQ 462
+E+++L LQ
Sbjct: 203 ATKTDCMKVLREVKVLAGLQ 222


>sp|Q9LMB9|CRK1_ARATH Cysteine-rich receptor-like protein kinase 1
OS=Arabidopsis thaliana GN=CRK1 PE=2 SV=2
Length = 615

Score = 39.3 bits (90), Expect = 0.011
Identities = 19/55 (34%), Positives = 35/55 (63%)
Frame = +1

Query: 313 KIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYI 477
K+G+GG+ V+K I DG I A+K++ R++A F+ E+ L++ +Q K+ +
Sbjct: 323 KLGQGGAGSVYKGILPDGRIVAVKKLFFNTREWADQ--FFNEVNLISGVQHKNLV 375


tr_hit_id Q8LN55
Definition tr|Q8LN55|Q8LN55_ORYSJ Putative uncharacterized protein Os03g49750 (Putative uncharacterized protein) OS=Oryza sativa subsp. japonica
Align length 67
Score (bit) 89.4
E-value 1.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913908|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_F11.
(505 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8LN55|Q8LN55_ORYSJ Putative uncharacterized protein Os03g497... 89 1e-17
tr|A2XL55|A2XL55_ORYSI Putative uncharacterized protein OS=Oryza... 89 1e-17
tr|Q75IA9|Q75IA9_ORYSJ Os03g0704400 protein OS=Oryza sativa subs... 89 1e-17
tr|Q84VX4|Q84VX4_ARATH At1g77720 (Putative uncharacterized prote... 88 1e-16
tr|Q9CA22|Q9CA22_ARATH Putative uncharacterized protein T32E8.5 ... 88 1e-16
tr|P93833|P93833_ARATH Putative uncharacterized protein PPK1 OS=... 88 1e-16
tr|A7NV76|A7NV76_VITVI Chromosome chr18 scaffold_1, whole genome... 87 6e-16
tr|A9TSV3|A9TSV3_PHYPA Predicted protein OS=Physcomitrella paten... 83 9e-15
tr|A9RE47|A9RE47_PHYPA Predicted protein (Fragment) OS=Physcomit... 80 4e-14
tr|Q759F9|Q759F9_ASHGO ADR317Cp OS=Ashbya gossypii GN=ADR317C PE... 64 4e-09
tr|Q019E0|Q019E0_OSTTA P21-activated serine/threonine protein ki... 61 3e-08
tr|A4S3T7|A4S3T7_OSTLU Predicted protein (Fragment) OS=Ostreococ... 61 3e-08
tr|B0CV45|B0CV45_LACBS Predicted protein (Fragment) OS=Laccaria ... 61 3e-08
tr|A8NS59|A8NS59_COPC7 Putative uncharacterized protein OS=Copri... 60 5e-08
tr|B2ATQ4|B2ATQ4_PODAN Predicted CDS Pa_1_16610 OS=Podospora ans... 59 1e-07
tr|A8ITP6|A8ITP6_CHLRE Predicted protein (Fragment) OS=Chlamydom... 57 5e-07
tr|B2WC24|B2WC24_PYRTR Negative regulator of the PHO system OS=P... 57 7e-07
tr|Q7SGE4|Q7SGE4_NEUCR Putative uncharacterized protein (Related... 56 9e-07
tr|Q6CUM2|Q6CUM2_KLULA KLLA0C03828p OS=Kluyveromyces lactis GN=K... 56 9e-07
tr|Q2H654|Q2H654_CHAGB Putative uncharacterized protein OS=Chaet... 55 1e-06
tr|Q0UUT3|Q0UUT3_PHANO Putative uncharacterized protein OS=Phaeo... 55 1e-06
tr|B5VFN8|B5VFN8_YEAS6 YDL028Cp-like protein OS=Saccharomyces ce... 55 2e-06
tr|B3LGT1|B3LGT1_YEAS1 Serine/threonine-protein kinase MPS1 OS=S... 55 2e-06
tr|A6ZXU3|A6ZXU3_YEAS7 Monopolar spindle OS=Saccharomyces cerevi... 55 2e-06
tr|A4RN93|A4RN93_MAGGR Putative uncharacterized protein OS=Magna... 55 2e-06
tr|A9UZI6|A9UZI6_MONBE Predicted protein OS=Monosiga brevicollis... 55 3e-06
tr|B6K601|B6K601_SCHJP Serine/threonine-protein kinase mph1 OS=S... 54 4e-06
tr|Q8SSH4|Q8SSH4_ENCCU MPS1-LIKE THR/TYR DUAL SPECIFICITY PROTEI... 54 6e-06
tr|A6R3Q8|A6R3Q8_AJECN Putative uncharacterized protein OS=Ajell... 53 7e-06
tr|A7E805|A7E805_SCLS1 Putative uncharacterized protein OS=Scler... 53 1e-05

>tr|Q8LN55|Q8LN55_ORYSJ Putative uncharacterized protein Os03g49750
(Putative uncharacterized protein) OS=Oryza sativa
subsp. japonica GN=Os03g49750 PE=4 SV=1
Length = 742

Score = 89.4 bits (220), Expect(2) = 1e-17
Identities = 47/67 (70%), Positives = 53/67 (79%)
Frame = +1

Query: 304 KAEKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIR 483
K KIG GGSSEV KVI + IYALK+IKLKGRDY TAYGF QEIE L KL+GKS II+
Sbjct: 404 KLGKIGSGGSSEVHKVISAECTIYALKKIKLKGRDYPTAYGFCQEIEYLNKLKGKSNIIQ 463

Query: 484 PINHEVT 504
I++EVT
Sbjct: 464 LIDYEVT 470



Score = 23.5 bits (49), Expect(2) = 1e-17
Identities = 11/24 (45%), Positives = 15/24 (62%)
Frame = +2

Query: 251 RKQGENDHFVWVNRRRYQKLKKLG 322
+K + D F VN + YQKL K+G
Sbjct: 386 KKNYDPDVFFKVNGKLYQKLGKIG 409


>tr|A2XL55|A2XL55_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_13200 PE=4 SV=1
Length = 742

Score = 89.4 bits (220), Expect(2) = 1e-17
Identities = 47/67 (70%), Positives = 53/67 (79%)
Frame = +1

Query: 304 KAEKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIR 483
K KIG GGSSEV KVI + IYALK+IKLKGRDY TAYGF QEIE L KL+GKS II+
Sbjct: 404 KLGKIGSGGSSEVHKVISAECTIYALKKIKLKGRDYPTAYGFCQEIEYLNKLKGKSNIIQ 463

Query: 484 PINHEVT 504
I++EVT
Sbjct: 464 LIDYEVT 470



Score = 23.5 bits (49), Expect(2) = 1e-17
Identities = 11/24 (45%), Positives = 15/24 (62%)
Frame = +2

Query: 251 RKQGENDHFVWVNRRRYQKLKKLG 322
+K + D F VN + YQKL K+G
Sbjct: 386 KKNYDPDVFFKVNGKLYQKLGKIG 409


>tr|Q75IA9|Q75IA9_ORYSJ Os03g0704400 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0004L11.1 PE=4 SV=1
Length = 741

Score = 89.4 bits (220), Expect(2) = 1e-17
Identities = 47/67 (70%), Positives = 53/67 (79%)
Frame = +1

Query: 304 KAEKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIR 483
K KIG GGSSEV KVI + IYALK+IKLKGRDY TAYGF QEIE L KL+GKS II+
Sbjct: 403 KLGKIGSGGSSEVHKVISAECTIYALKKIKLKGRDYPTAYGFCQEIEYLNKLKGKSNIIQ 462

Query: 484 PINHEVT 504
I++EVT
Sbjct: 463 LIDYEVT 469



Score = 23.5 bits (49), Expect(2) = 1e-17
Identities = 11/24 (45%), Positives = 15/24 (62%)
Frame = +2

Query: 251 RKQGENDHFVWVNRRRYQKLKKLG 322
+K + D F VN + YQKL K+G
Sbjct: 385 KKNYDPDVFFKVNGKLYQKLGKIG 408


>tr|Q84VX4|Q84VX4_ARATH At1g77720 (Putative uncharacterized protein
At1g77720) OS=Arabidopsis thaliana GN=At1g77720 PE=2
SV=1
Length = 777

Score = 87.8 bits (216), Expect(2) = 1e-16
Identities = 46/64 (71%), Positives = 52/64 (81%)
Frame = +1

Query: 313 KIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIRPIN 492
KIG GGSSEV KVI D IYALK+IKLKGRDYATAYGF QEI L KL+GK+ II+ I+
Sbjct: 405 KIGSGGSSEVHKVISSDCTIYALKKIKLKGRDYATAYGFCQEIGYLKKLKGKTNIIQLID 464

Query: 493 HEVT 504
+EVT
Sbjct: 465 YEVT 468



Score = 21.6 bits (44), Expect(2) = 1e-16
Identities = 10/28 (35%), Positives = 16/28 (57%)
Frame = +2

Query: 239 SMQSRKQGENDHFVWVNRRRYQKLKKLG 322
S ++ + D F VN + YQ+L K+G
Sbjct: 380 SAPRKRNYDPDLFFKVNGKLYQRLGKIG 407


>tr|Q9CA22|Q9CA22_ARATH Putative uncharacterized protein T32E8.5
OS=Arabidopsis thaliana GN=T32E8.5 PE=4 SV=1
Length = 720

Score = 87.8 bits (216), Expect(2) = 1e-16
Identities = 46/64 (71%), Positives = 52/64 (81%)
Frame = +1

Query: 313 KIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIRPIN 492
KIG GGSSEV KVI D IYALK+IKLKGRDYATAYGF QEI L KL+GK+ II+ I+
Sbjct: 348 KIGSGGSSEVHKVISSDCTIYALKKIKLKGRDYATAYGFCQEIGYLKKLKGKTNIIQLID 407

Query: 493 HEVT 504
+EVT
Sbjct: 408 YEVT 411



Score = 21.6 bits (44), Expect(2) = 1e-16
Identities = 10/28 (35%), Positives = 16/28 (57%)
Frame = +2

Query: 239 SMQSRKQGENDHFVWVNRRRYQKLKKLG 322
S ++ + D F VN + YQ+L K+G
Sbjct: 323 SAPRKRNYDPDLFFKVNGKLYQRLGKIG 350


>tr|P93833|P93833_ARATH Putative uncharacterized protein PPK1
OS=Arabidopsis thaliana GN=PPK1 PE=2 SV=1
Length = 519

Score = 87.8 bits (216), Expect(2) = 1e-16
Identities = 46/64 (71%), Positives = 52/64 (81%)
Frame = +1

Query: 313 KIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIRPIN 492
KIG GGSSEV KVI D IYALK+IKLKGRDYATAYGF QEI L KL+GK+ II+ I+
Sbjct: 152 KIGSGGSSEVHKVISSDCTIYALKKIKLKGRDYATAYGFCQEIGYLKKLKGKTNIIQLID 211

Query: 493 HEVT 504
+EVT
Sbjct: 212 YEVT 215



Score = 21.6 bits (44), Expect(2) = 1e-16
Identities = 10/28 (35%), Positives = 16/28 (57%)
Frame = +2

Query: 239 SMQSRKQGENDHFVWVNRRRYQKLKKLG 322
S ++ + D F VN + YQ+L K+G
Sbjct: 127 SAPRKRNYDPDLFFKVNGKLYQRLGKIG 154


>tr|A7NV76|A7NV76_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015329001
PE=4 SV=1
Length = 366

Score = 86.7 bits (213), Expect = 6e-16
Identities = 44/62 (70%), Positives = 52/62 (83%)
Frame = +1

Query: 313 KIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIRPIN 492
KIG GGSSEV KVI D +IYALK+I+LKGRDYATAYGF QEI+ L KL+GKS II+ I+
Sbjct: 15 KIGSGGSSEVHKVISSDCSIYALKKIRLKGRDYATAYGFCQEIQYLNKLKGKSNIIQLID 74

Query: 493 HE 498
+E
Sbjct: 75 YE 76


>tr|A9TSV3|A9TSV3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_150031 PE=4 SV=1
Length = 360

Score = 82.8 bits (203), Expect = 9e-15
Identities = 44/78 (56%), Positives = 56/78 (71%)
Frame = +1

Query: 271 SFCMGESQKVSKAEKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELL 450
+F + K KIG+GGSSEVFKVI + +IYALKRI LKGRD++TA FYQEI+ L
Sbjct: 9 NFVYVNGTRYQKLGKIGKGGSSEVFKVIATNCSIYALKRINLKGRDWSTAQEFYQEIKYL 68

Query: 451 TKLQGKSYIIRPINHEVT 504
L+GK +II+ I+ EVT
Sbjct: 69 KALRGKRHIIQLIDSEVT 86



Score = 33.5 bits (75), Expect = 6.0
Identities = 14/25 (56%), Positives = 20/25 (80%)
Frame = +2

Query: 251 RKQGENDHFVWVNRRRYQKLKKLGE 325
R + EN++FV+VN RYQKL K+G+
Sbjct: 2 RTETENENFVYVNGTRYQKLGKIGK 26


>tr|A9RE47|A9RE47_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_22621 PE=4 SV=1
Length = 332

Score = 80.5 bits (197), Expect = 4e-14
Identities = 41/70 (58%), Positives = 54/70 (77%)
Frame = +1

Query: 295 KVSKAEKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSY 474
+ K +IG+GGSSEVFKVI + +IYALKRI LKGRD++TA FYQEI+ L L+GK +
Sbjct: 30 RYQKLGQIGKGGSSEVFKVIASNCSIYALKRINLKGRDWSTAQEFYQEIKYLKALRGKRH 89

Query: 475 IIRPINHEVT 504
II+ ++ EVT
Sbjct: 90 IIQLVDSEVT 99



Score = 36.6 bits (83), Expect = 0.71
Identities = 16/27 (59%), Positives = 22/27 (81%)
Frame = +2

Query: 245 QSRKQGENDHFVWVNRRRYQKLKKLGE 325
+SR + ENDHFV+VN RYQKL ++G+
Sbjct: 13 KSRTEIENDHFVYVNGIRYQKLGQIGK 39


>tr|Q759F9|Q759F9_ASHGO ADR317Cp OS=Ashbya gossypii GN=ADR317C PE=4
SV=1
Length = 819

Score = 63.9 bits (154), Expect = 4e-09
Identities = 32/66 (48%), Positives = 46/66 (69%)
Frame = +1

Query: 304 KAEKIGRGGSSEVFKVIDRDGNIYALKRIKLKGRDYATAYGFYQEIELLTKLQGKSYIIR 483
K E +GRGGSS+V+KV + IYALKR+ D A+A GF EIELL KL+ ++ +++
Sbjct: 494 KVELLGRGGSSKVYKVRNSSNRIYALKRVSFDEFDDASADGFKGEIELLKKLENQTRVVK 553

Query: 484 PINHEV 501
I+HE+
Sbjct: 554 LIDHEM 559