BP913909
Clone id YMU001_000037_F12
Library
Length 530
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_F12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACTGGAGTTCACTTATGGAATCTTTGAAGAGTCCTGTCTTCCTCATTGGGGAACATGTG
AGAACTCACTGGATTCATCGGGAAAAATCCCATGGGTAATCCAGGCCTGGGAGGACCAAA
ATCTGCTTGACCGTGATGAAAAGGATAGGCAAAATGCGGTAACCTTCTATTCCAATCGGC
ACCTCGTCTATCATATCCATCTCCATAATTCGGTACCCATTCTTCTCCGCCCCACTTGGA
TTTTCGCTCCCCTTGCCCCCAGTTACCGCCTGATGGTAAAGCTTCTCTGAAATCTTGACC
TCGCATGCCATTGGCCTGCATATAGGCACCTTGACCCCTACCTCCCGCTGCTAGTCTGTC
ACGACCTTCAGTAGCTCCAGCCTGGCCATCCCGTCTCCTGCTGTACACATTGCCTTGAGT
CAGTATCGCCCTCCTCTGAGCCTAAATTACTGCTTCTCAGCCCACGCTTCCAGGCCTCTG
TATCACACCGTCCCTTCTCTGAATCCCAATTTGAAGCCTCTCCATCGGGA
■■Homology search results ■■ -
sp_hit_id Q9Z130
Definition sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus
Align length 97
Score (bit) 37.7
E-value 0.034
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913909|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_F12.
(530 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-... 38 0.034
sp|Q16VD3|LIG_AEDAE Protein lingerer OS=Aedes aegypti GN=lig PE=... 36 0.10
sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-... 36 0.10
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophil... 36 0.13
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo ... 35 0.29
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor ... 34 0.50
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo s... 34 0.50
sp|Q9JIK5|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus G... 33 0.65
sp|Q66K80|CA104_HUMAN Uncharacterized protein C1orf104 OS=Homo s... 33 0.65
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia... 33 0.85
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 O... 33 0.85
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus mu... 33 1.1
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3 OS=Ara... 32 1.4
sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal O... 32 1.4
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapien... 32 1.9
sp|Q9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 OS=Homo... 32 1.9
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharo... 32 1.9
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharo... 32 1.9
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosa... 32 1.9
sp|Q1WUT3|SYL_LACS1 Leucyl-tRNA synthetase OS=Lactobacillus sali... 31 4.2
sp|P19837|SPD1_NEPCL Spidroin-1 (Fragment) OS=Nephila clavipes P... 31 4.2
sp|Q6NYU2|HELZ_DANRE Probable helicase with zinc finger domain O... 31 4.2
sp|Q67VS5|HAK10_ORYSJ Potassium transporter 10 OS=Oryza sativa s... 31 4.2
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan tr... 31 4.2
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo s... 31 4.2
sp|O93235|CIRBP_XENLA Cold-inducible RNA-binding protein OS=Xeno... 31 4.2
sp|Q8TAP9|TTDN1_HUMAN TTD non-photosensitive 1 protein OS=Homo s... 30 5.5
sp|Q9HCM2|PLXA4_HUMAN Plexin-A4 OS=Homo sapiens GN=PLXNA4 PE=1 SV=4 30 5.5
sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Ni... 30 7.2
sp|Q48754|TCSA_LISMO CD4+ T-cell-stimulating antigen OS=Listeria... 30 7.2

>sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein
D-like OS=Mus musculus GN=Hnrpdl PE=1 SV=1
Length = 301

Score = 37.7 bits (86), Expect = 0.034
Identities = 32/97 (32%), Positives = 49/97 (50%)
Frame = -3

Query: 408 VYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSKWG 229
VY +++ Q G GR AAGGRG GA + G +GQ++ + + + G G S +G
Sbjct: 194 VYRQQQQQQKG---GRGA-AAGGRG-GARGRGRG-QGQNWNQGFNNYYDQGYGNYNSAYG 247

Query: 228 GEEWVPNYGDGYDRRGADWNRRLPHFAYPFHHGQADF 118
G++ YG GYD G ++ Y + G AD+
Sbjct: 248 GDQNYSGYG-GYDYTGYNYGN------YGYGQGYADY 277


>sp|Q16VD3|LIG_AEDAE Protein lingerer OS=Aedes aegypti GN=lig PE=3
SV=1
Length = 1250

Score = 36.2 bits (82), Expect = 0.10
Identities = 20/56 (35%), Positives = 27/56 (48%)
Frame = -3

Query: 393 RDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSKWGG 226
RDG+ G R+ GGRG RG+D R+ P G++G G R + GG
Sbjct: 229 RDGERGGDRDRNGFDRGGRGP---------RGRDGRDGGPGRGSYGGGSRGGRGGG 275


>sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein
D-like OS=Homo sapiens GN=HNRPDL PE=1 SV=3
Length = 420

Score = 36.2 bits (82), Expect = 0.10
Identities = 31/97 (31%), Positives = 48/97 (49%)
Frame = -3

Query: 408 VYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSKWG 229
VY +++ Q G GR AAGGRG G + G +GQ++ + + + G G S +G
Sbjct: 313 VYRQQQQQQKG---GRGA-AAGGRG-GTRGRGRG-QGQNWNQGFNNYYDQGYGNYNSAYG 366

Query: 228 GEEWVPNYGDGYDRRGADWNRRLPHFAYPFHHGQADF 118
G++ YG GYD G ++ Y + G AD+
Sbjct: 367 GDQNYSGYG-GYDYTGYNYGN------YGYGQGYADY 396


>sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila
melanogaster GN=bel PE=1 SV=1
Length = 798

Score = 35.8 bits (81), Expect = 0.13
Identities = 29/88 (32%), Positives = 38/88 (43%), Gaps = 4/88 (4%)
Frame = -3

Query: 417 QGNVYSRRRDGQAG--ATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGER 244
QG + D ++G E RD + G G G Y + G G+ F G +G G
Sbjct: 68 QGQGQGQGFDSRSGNPRQETRDPQQSRGGG-GEYRRGGGGGGRGFNRQSGDYG-YGSGGG 125

Query: 243 KSKWGGEEWVPNYGDGY--DRRGADWNR 166
+ GG + NY G RRG DWNR
Sbjct: 126 GRRGGGGRFEDNYNGGEFDSRRGGDWNR 153


>sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo
abelii GN=DDX3Y PE=2 SV=1
Length = 658

Score = 34.7 bits (78), Expect = 0.29
Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 7/76 (9%)
Frame = -3

Query: 378 GATEGRDRLAAGGRGQGAYMQANGMRGQDF---REALPSGGNWGQGERKS----KWGGEE 220
G + GR + +GG G Y Q++G F R + G G G + +GG
Sbjct: 580 GGSRGRSKRFSGGFGARDYRQSSGSSSSGFGASRGSSSRSGGSGYGNSRGFGGGGYGGFY 639

Query: 219 WVPNYGDGYDRRGADW 172
YG Y+ +G DW
Sbjct: 640 NSDGYGGNYNSQGVDW 655


>sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA
OS=Emericella nidulans GN=nirA PE=4 SV=1
Length = 892

Score = 33.9 bits (76), Expect = 0.50
Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 8/75 (10%)
Frame = -3

Query: 261 WGQGERKSKWGGEEWVPNYGDGYDRRGADWN-----RRLPHFAYPFHHGQADFGPPRPGL 97
W + + G E+W N+ +G ADW +P + P AD+ PP+P
Sbjct: 806 WSRDVNALQLGAEDWTQNWNNGLPTTSADWRYVDNVPNIPSTSAP----DADYKPPQPPP 861

Query: 96 PM---GFFPMNPVSS 61
M +P +PV++
Sbjct: 862 NMARPNQYPTDPVAN 876


>sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo
sapiens GN=DDX3X PE=1 SV=3
Length = 662

Score = 33.9 bits (76), Expect = 0.50
Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 9/78 (11%)
Frame = -3

Query: 378 GATEGRDRLA--AGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSK-------WGG 226
G++ GR + + +GG G Y Q++G F + S G G S +GG
Sbjct: 582 GSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGG 641

Query: 225 EEWVPNYGDGYDRRGADW 172
YG Y+ +G DW
Sbjct: 642 FYNSDGYGGNYNSQGVDW 659


>sp|Q9JIK5|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus
GN=Ddx21 PE=1 SV=2
Length = 851

Score = 33.5 bits (75), Expect = 0.65
Identities = 24/58 (41%), Positives = 29/58 (50%)
Frame = -3

Query: 396 RRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSKWGGE 223
+RDG GA G+ + RGQG Q G R +FR P GGN GQ SK G+
Sbjct: 799 QRDGSRGAFRGQRGGSRNFRGQG---QRGGSR--NFRGQRPGGGNRGQKRSFSKAFGQ 851


>sp|Q66K80|CA104_HUMAN Uncharacterized protein C1orf104 OS=Homo
sapiens GN=C1orf104 PE=2 SV=1
Length = 236

Score = 33.5 bits (75), Expect = 0.65
Identities = 33/108 (30%), Positives = 42/108 (38%)
Frame = -3

Query: 324 YMQANGMRGQDFREALPSGGNWGQGERKSKWGGEEWVPNYGDGYDRRGADWNRRLPHFAY 145
Y Q G R + +AL GG WG G +S G E G G ++ GA + PH
Sbjct: 47 YSQRKGPR-ETHPDALKGGGGWGWGNTQSLSG--ECRKGVGAGEEKDGAAVSLSTPHLL- 102

Query: 144 PFHHGQADFGPPRPGLPMGFFPMNPVSSHMFPNEEDRTLQRFHK*TPV 1
A P L P +P SS F + RTL F P+
Sbjct: 103 ---AASAGLQPAPSPLGTAVCPFSPHSSPSFSHH--RTLSLFISPAPL 145


>sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia
lipolytica GN=DED1 PE=3 SV=1
Length = 618

Score = 33.1 bits (74), Expect = 0.85
Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
Frame = -3

Query: 345 GGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSKWGGEEWVPNYGDG--YDRRGADW 172
GGRG+G + QDFR+ GG +G +R +GG +YG G Y +G +
Sbjct: 562 GGRGRGGFGGGRSRATQDFRK---QGGGFGSNDR---FGGSSGGSSYGGGSSYGNQGGNN 615

Query: 171 N 169
N
Sbjct: 616 N 616


tr_hit_id B5DWF0
Definition tr|B5DWF0|B5DWF0_DROPS GA27302 OS=Drosophila pseudoobscura pseudoobscura
Align length 93
Score (bit) 42.4
E-value 0.015
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913909|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_F12.
(530 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B5DWF0|B5DWF0_DROPS GA27302 OS=Drosophila pseudoobscura pseud... 42 0.015
tr|B4G457|B4G457_DROPE GL24500 OS=Drosophila persimilis GN=GL245... 42 0.015
tr|B6MZ12|B6MZ12_BRAFL Putative uncharacterized protein OS=Branc... 40 0.056
tr|B2VWF2|B2VWF2_PYRTR 5'-3' exoribonuclease 2 OS=Pyrenophora tr... 40 0.096
tr|A2DLV5|A2DLV5_TRIVA Putative uncharacterized protein OS=Trich... 39 0.13
tr|Q4RT50|Q4RT50_TETNG Chromosome 12 SCAF14999, whole genome sho... 35 0.14
tr|Q5KC81|Q5KC81_CRYNE Putative uncharacterized protein OS=Crypt... 39 0.16
tr|Q5DUI5|Q5DUI5_PARTE NOWA1 protein OS=Paramecium tetraurelia G... 39 0.21
tr|A0CDB6|A0CDB6_PARTE Chromosome undetermined scaffold_17, whol... 39 0.21
tr|Q9BIU0|Q9BIU0_9ARAC Major ampullate spidroin 1 (Fragment) OS=... 38 0.37
tr|B3P4V3|B3P4V3_DROER GG17436 OS=Drosophila erecta GN=GG17436 P... 37 0.48
tr|B0W9V7|B0W9V7_CULQU Putative uncharacterized protein OS=Culex... 37 0.48
tr|B4NLA8|B4NLA8_DROWI GK14071 OS=Drosophila willistoni GN=GK140... 37 0.62
tr|Q4JF00|Q4JF00_PLADU PL10a protein OS=Platynereis dumerilii PE... 37 0.81
tr|Q4JEZ9|Q4JEZ9_PLADU PL10b protein OS=Platynereis dumerilii PE... 37 0.81
tr|B2AUI1|B2AUI1_PODAN Predicted CDS Pa_1_19200 OS=Podospora ans... 37 0.81
tr|Q728Y5|Q728Y5_DESVH Ribonuclease R OS=Desulfovibrio vulgaris ... 36 1.1
tr|Q7F8Z5|Q7F8Z5_ORYSJ OSJNBb0033P05.5 protein OS=Oryza sativa s... 36 1.1
tr|Q2HJH4|Q2HJH4_BOVIN HNRPDL protein (Fragment) OS=Bos taurus G... 36 1.1
tr|A4IF81|A4IF81_BOVIN HNRPDL protein OS=Bos taurus GN=HNRPDL PE... 36 1.1
tr|B5DTS4|B5DTS4_DROPS GA23149 OS=Drosophila pseudoobscura pseud... 36 1.1
tr|B4PT81|B4PT81_DROYA Bel OS=Drosophila yakuba GN=Dyak\bel PE=4... 36 1.1
tr|B4KLB4|B4KLB4_DROMO GI13281 OS=Drosophila mojavensis GN=GI132... 36 1.1
tr|B4DTA2|B4DTA2_HUMAN cDNA FLJ60148, highly similar to Homo sap... 36 1.1
tr|B4DGN3|B4DGN3_HUMAN cDNA FLJ59198, highly similar to Homo sap... 36 1.1
tr|A9BNS0|A9BNS0_DELAS DEAD/DEAH box helicase domain protein OS=... 36 1.4
tr|B4QY02|B4QY02_DROSI GD20854 OS=Drosophila simulans GN=GD20854... 36 1.4
tr|B4HL39|B4HL39_DROSE GM26328 OS=Drosophila sechellia GN=GM2632... 36 1.4
tr|B3LWX3|B3LWX3_DROAN GF16329 OS=Drosophila ananassae GN=GF1632... 36 1.4
tr|A4HF63|A4HF63_LEIBR Putative uncharacterized protein OS=Leish... 36 1.4

>tr|B5DWF0|B5DWF0_DROPS GA27302 OS=Drosophila pseudoobscura
pseudoobscura GN=GA27302 PE=4 SV=1
Length = 800

Score = 42.4 bits (98), Expect = 0.015
Identities = 31/93 (33%), Positives = 40/93 (43%), Gaps = 10/93 (10%)
Frame = -3

Query: 414 GNVYSRRRDGQAGATEGRDRLAAGGRGQ---------GAYMQANGMRGQDFREALPSGGN 262
GN + D Q G +G D AA R G Y + G G+ + G+
Sbjct: 56 GNNNAAEVDSQ-GQGQGFDSRAANPRADSREPQQNRSGEYRRGGGGGGRGYNRQSGEYGS 114

Query: 261 WGQGERKSKWGGEEWVPNY-GDGYDRRGADWNR 166
+G G R+ GG + NY GD RRG DWNR
Sbjct: 115 FGGGGRRGGGGGGRFEDNYNGDFESRRGGDWNR 147


>tr|B4G457|B4G457_DROPE GL24500 OS=Drosophila persimilis GN=GL24500
PE=4 SV=1
Length = 799

Score = 42.4 bits (98), Expect = 0.015
Identities = 31/93 (33%), Positives = 40/93 (43%), Gaps = 10/93 (10%)
Frame = -3

Query: 414 GNVYSRRRDGQAGATEGRDRLAAGGRGQ---------GAYMQANGMRGQDFREALPSGGN 262
GN + D Q G +G D AA R G Y + G G+ + G+
Sbjct: 56 GNNNAAEVDSQ-GQGQGFDSRAANPRADSREPQQNRSGEYRRGGGGGGRGYNRQSGEYGS 114

Query: 261 WGQGERKSKWGGEEWVPNY-GDGYDRRGADWNR 166
+G G R+ GG + NY GD RRG DWNR
Sbjct: 115 FGGGGRRGGGGGGRFEDNYNGDFESRRGGDWNR 147


>tr|B6MZ12|B6MZ12_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_125234 PE=4 SV=1
Length = 1225

Score = 40.4 bits (93), Expect = 0.056
Identities = 36/126 (28%), Positives = 54/126 (42%), Gaps = 5/126 (3%)
Frame = -3

Query: 393 RDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSKWGGEEWV 214
RDG + G R+A GG G+ + NGM + +E G G+G+R+++
Sbjct: 211 RDGSSSRGRGPPRMARGGGRGGSRPRENGM--AEDKEGSRDRGGRGRGDRRNRG------ 262

Query: 213 PNYGDGYDRRGADWNRRLPHFAYPFHHGQADFGPPR-PGLPMGFFPMNPV----SSHMFP 49
DR G R H P G+ FG PR G +G F + + +S ++P
Sbjct: 263 -------DRDGDRRPGRFGHMNGPSRPGRGGFGRPRHDGPKIGTFNPDEIKTEKTSDIWP 315

Query: 48 NEEDRT 31
N E T
Sbjct: 316 NTESGT 321


>tr|B2VWF2|B2VWF2_PYRTR 5'-3' exoribonuclease 2 OS=Pyrenophora
tritici-repentis (strain Pt-1C-BFP) GN=PTRG_01514 PE=4
SV=1
Length = 1104

Score = 39.7 bits (91), Expect = 0.096
Identities = 37/118 (31%), Positives = 46/118 (38%)
Frame = -3

Query: 423 LTQGNVYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGER 244
L G S RR+ + G GR R GGRG G G + R +GG G +
Sbjct: 864 LQPGEAESVRRNNERGGFRGRGR---GGRGGGG-------GGYNDRRENQNGGGRGGYQN 913

Query: 243 KSKWGGEEWVPNYGDGYDRRGADWNRRLPHFAYPFHHGQADFGPPRPGLPMGFFPMNP 70
GG W N G GY+ + P +P A+F PP G FFP P
Sbjct: 914 GRGAGGGGWDNNRG-GYNGNQGGYGGPPPPHNFPPPFPGANFAPPPGG---NFFPPPP 967


>tr|A2DLV5|A2DLV5_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_462440 PE=4 SV=1
Length = 345

Score = 39.3 bits (90), Expect = 0.13
Identities = 29/80 (36%), Positives = 34/80 (42%), Gaps = 1/80 (1%)
Frame = -3

Query: 417 QGNVYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKS 238
+G S RD G GRDR GG G+G Y + G R + GG G G R
Sbjct: 220 EGGYDSYGRDSGYGGGYGRDRYGGGGYGRGGYGDSYGGRDR-------YGGGGGYGGRDR 272

Query: 237 KWGGEEWVPNY-GDGYDRRG 181
GG Y GD Y+R G
Sbjct: 273 YGGGGYGRGGYGGDDYNRGG 292


>tr|Q4RT50|Q4RT50_TETNG Chromosome 12 SCAF14999, whole genome
shotgun sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00029417001 PE=4 SV=1
Length = 707

Score = 34.7 bits (78), Expect(2) = 0.14
Identities = 27/81 (33%), Positives = 31/81 (38%), Gaps = 6/81 (7%)
Frame = -3

Query: 393 RDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSKWGGEEWV 214
R G G GR R AGGRG+G N + Q P+ G R+ W GE
Sbjct: 165 RGGDRGR-RGRGR-GAGGRGRGRAAAGNRVPSQGMGTFNPTDFTANSGNRQEAWNGEGKD 222

Query: 213 PNYGDG------YDRRGADWN 169
P G G D DWN
Sbjct: 223 PAEGTGTWGGPTEDWTSEDWN 243



Score = 23.5 bits (49), Expect(2) = 0.14
Identities = 9/32 (28%), Positives = 18/32 (56%)
Frame = -2

Query: 484 DTEAWKRGLRSSNLGSEEGDTDSRQCVQQETG 389
DT +W+ + NLG E G ++ ++ ++ G
Sbjct: 96 DTTSWETVGKKRNLGKEGGSSEIKEISDKKGG 127


>tr|Q5KC81|Q5KC81_CRYNE Putative uncharacterized protein
OS=Cryptococcus neoformans GN=CNH00090 PE=4 SV=1
Length = 1661

Score = 38.9 bits (89), Expect = 0.16
Identities = 35/99 (35%), Positives = 38/99 (38%), Gaps = 4/99 (4%)
Frame = -3

Query: 387 GQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSKWG--GEEWV 214
G AG GR R AAGG +GA G RG GG G G WG G W
Sbjct: 238 GPAGGGGGRGRGAAGGEQEGA-CAGGGGRGGGAGVCGGGGGRAGAGGGAGAWGAAGSAWA 296

Query: 213 PNYGDGYDRRGADWNRRLPHFAYPF-HHGQA-DFGPPRP 103
R A W +L + F HH A GPP P
Sbjct: 297 A-------ARCAWWGLKLSSARHMFYHHAHALALGPPSP 328


>tr|Q5DUI5|Q5DUI5_PARTE NOWA1 protein OS=Paramecium tetraurelia
GN=nowa1 PE=4 SV=1
Length = 1024

Score = 38.5 bits (88), Expect = 0.21
Identities = 27/88 (30%), Positives = 33/88 (37%), Gaps = 7/88 (7%)
Frame = -3

Query: 414 GNVYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSK 235
G + R DG G + DR G RG+G G R FR +GG+WG +
Sbjct: 156 GEGFRGRGDGFRGRGDRGDR--GGFRGRGDRGGDRGDRRGGFRGGRDNGGSWGGNSSNNN 213

Query: 234 WGGEEWVPN-------YGDGYDRRGADW 172
GG W N D D G W
Sbjct: 214 GGGNSWGGNAEGSSWGNSDNKDNAGGGW 241


>tr|A0CDB6|A0CDB6_PARTE Chromosome undetermined scaffold_17, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00006994001 PE=4 SV=1
Length = 1015

Score = 38.5 bits (88), Expect = 0.21
Identities = 27/88 (30%), Positives = 33/88 (37%), Gaps = 7/88 (7%)
Frame = -3

Query: 414 GNVYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSK 235
G + R DG G + DR G RG+G G R FR +GG+WG +
Sbjct: 156 GEGFRGRGDGFRGRGDRGDR--GGFRGRGDRGGDRGDRRGGFRGGRDNGGSWGGNSSNNN 213

Query: 234 WGGEEWVPN-------YGDGYDRRGADW 172
GG W N D D G W
Sbjct: 214 GGGNSWGGNAEGSSWGNSDNKDNAGGGW 241


>tr|Q9BIU0|Q9BIU0_9ARAC Major ampullate spidroin 1 (Fragment)
OS=Latrodectus geometricus GN=MaSp1 PE=2 SV=1
Length = 360

Score = 37.7 bits (86), Expect = 0.37
Identities = 29/79 (36%), Positives = 35/79 (44%)
Frame = -3

Query: 414 GNVYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSK 235
G Y + GQ GA AAGG GQG Y + +G A +GG GQG +
Sbjct: 100 GQGYGQGGAGQGGAGAAAAAAAAGGAGQGGYGRGGAGQGGAAAAAAAAGGA-GQGGQ--- 155

Query: 234 WGGEEWVPNYGDGYDRRGA 178
GG YG GY + GA
Sbjct: 156 -GG------YGQGYGQGGA 167



Score = 35.0 bits (79), Expect = 2.4
Identities = 26/79 (32%), Positives = 30/79 (37%)
Frame = -3

Query: 414 GNVYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSGGNWGQGERKSK 235
G Y + GQ GA AAGG GQG Y + +G A G GQG
Sbjct: 44 GQGYGQGGAGQGGAGAAA-AAAAGGAGQGGYGRGGAGQGAAAAAAAAGSGQGGQG----- 97

Query: 234 WGGEEWVPNYGDGYDRRGA 178
YG GY + GA
Sbjct: 98 --------GYGQGYGQGGA 108



Score = 34.7 bits (78), Expect = 3.1
Identities = 29/95 (30%), Positives = 35/95 (36%), Gaps = 16/95 (16%)
Frame = -3

Query: 414 GNVYSRRRDGQAGATEGRDRLAAGGRGQGAYMQANGMRGQDFREALPSG---------GN 262
G Y + GQ GA AAGG GQG Y + +G A +G G
Sbjct: 159 GQGYGQGGAGQGGAGAAAAAAAAGGAGQGGYGRGGAGQGGSAAAAAAAGGAGQGGYGRGG 218

Query: 261 WGQGERKSK-------WGGEEWVPNYGDGYDRRGA 178
GQG S G+ YG GY + GA
Sbjct: 219 AGQGGAGSAAAAAAAGGSGQGGQGGYGQGYGQGGA 253