BP913918
Clone id YMU001_000037_G09
Library
Length 489
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000037_G09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAGGTATCCATCTAGAGGTTGTAACACCCTTAATGGTGACTTGTTGTTGGCTCTGCCTA
TTGATTGTGTGCCTTTGGGTGGAGCCTTGTGGTGCTTCTTGATTAAGCACCATTTTTCTA
CGTTAAGCTACAATTTTTGGTAACTATATTTGATTGTTACCTTCATAAAATACTTGTGCT
TCAGGTAGCTTAACTGGAATCATCCACACTTTGATACCCATACTTGTTGTGTTTCTTTCT
TTGAAGGTCTTTTCTTTTGTCCTTTTTTGTTGTTCTTTCTCCTGCTTGAGTTGTTTTTAT
TCCGTTGATAGCTTGGCTTGCTCATGTAGAACTTCTTTCTTGAGGTGAGTACATACAGGC
TGTTACTTTAGGCTTTTTGGCCCAAACATTAATTTTTCCTTCAAAGTAGCCTTGAGCAGT
GATTGACTCATTTGATGCTACCCCCCTGTCACCTTTTGCGTTGAGGCTGAACATGTGCTT
CATGTATCC
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913918|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_G09.
(489 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id B4HYQ6
Definition tr|B4HYQ6|B4HYQ6_DROSE GM12748 OS=Drosophila sechellia
Align length 69
Score (bit) 34.7
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913918|Adiantum capillus-veneris mRNA, clone:
YMU001_000037_G09.
(489 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4HYQ6|B4HYQ6_DROSE GM12748 OS=Drosophila sechellia GN=GM1274... 35 2.5
tr|B3VFH4|B3VFH4_9HIV1 Envelope glycoprotein OS=Human immunodefi... 33 7.1
tr|B3VFH1|B3VFH1_9HIV1 Envelope glycoprotein OS=Human immunodefi... 33 7.1
tr|B3VFH0|B3VFH0_9HIV1 Envelope glycoprotein OS=Human immunodefi... 33 7.1
tr|B3VFG9|B3VFG9_9HIV1 Envelope glycoprotein OS=Human immunodefi... 33 7.1
tr|B3VFG8|B3VFG8_9HIV1 Envelope glycoprotein OS=Human immunodefi... 33 7.1
tr|B3VFG7|B3VFG7_9HIV1 Envelope glycoprotein OS=Human immunodefi... 33 7.1
tr|Q71846|Q71846_9HIV1 Envelope glycoprotein, V3-V5 region (Frag... 33 9.3
tr|Q71388|Q71388_9HIV1 Envelope protein (Fragment) OS=Human immu... 33 9.3
tr|Q2ESM7|Q2ESM7_BACTU Hypothetical conjugation protein OS=Bacil... 33 9.3

>tr|B4HYQ6|B4HYQ6_DROSE GM12748 OS=Drosophila sechellia GN=GM12748
PE=4 SV=1
Length = 1002

Score = 34.7 bits (78), Expect = 2.5
Identities = 21/69 (30%), Positives = 33/69 (47%)
Frame = -2

Query: 218 GIKVWMIPVKLPEAQVFYEGNNQI*LPKIVA*RRKMVLNQEAPQGSTQRHTINRQSQQQV 39
G++ W +P ++ F+ P + ++M+LNQE Q Q+HT+ Q QQQ
Sbjct: 799 GVRNWAVPYLQSKSVSFHT-------PALHESIQQMILNQEQNQDQAQQHTVPPQEQQQQ 851

Query: 38 TIKGVTTSR 12
V T R
Sbjct: 852 QRSFVRTRR 860


>tr|B3VFH4|B3VFH4_9HIV1 Envelope glycoprotein OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 865

Score = 33.1 bits (74), Expect = 7.1
Identities = 21/62 (33%), Positives = 31/62 (50%)
Frame = -1

Query: 465 LNAKGDRGVASNESITAQGYFEGKINVWAKKPKVTACMYSPQERSST*ASQAINGIKTTQ 286
LN+ G+ SN++IT Q + IN+W +V MY+P R S I G+ T+
Sbjct: 407 LNSTGNGTEGSNDTITLQCRIKQIINMW---QEVGKAMYAPPIRGQIKCSSNITGLLLTR 463

Query: 285 AG 280
G
Sbjct: 464 DG 465


>tr|B3VFH1|B3VFH1_9HIV1 Envelope glycoprotein OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 865

Score = 33.1 bits (74), Expect = 7.1
Identities = 21/62 (33%), Positives = 31/62 (50%)
Frame = -1

Query: 465 LNAKGDRGVASNESITAQGYFEGKINVWAKKPKVTACMYSPQERSST*ASQAINGIKTTQ 286
LN+ G+ SN++IT Q + IN+W +V MY+P R S I G+ T+
Sbjct: 407 LNSTGNGTEGSNDTITLQCRIKQIINMW---QEVGKAMYAPPIRGQIKCSSNITGLLLTR 463

Query: 285 AG 280
G
Sbjct: 464 DG 465


>tr|B3VFH0|B3VFH0_9HIV1 Envelope glycoprotein OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 865

Score = 33.1 bits (74), Expect = 7.1
Identities = 21/62 (33%), Positives = 31/62 (50%)
Frame = -1

Query: 465 LNAKGDRGVASNESITAQGYFEGKINVWAKKPKVTACMYSPQERSST*ASQAINGIKTTQ 286
LN+ G+ SN++IT Q + IN+W +V MY+P R S I G+ T+
Sbjct: 407 LNSTGNGTEGSNDTITLQCRIKQIINMW---QEVGKAMYAPPIRGQIKCSSNITGLLLTR 463

Query: 285 AG 280
G
Sbjct: 464 DG 465


>tr|B3VFG9|B3VFG9_9HIV1 Envelope glycoprotein OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 866

Score = 33.1 bits (74), Expect = 7.1
Identities = 21/62 (33%), Positives = 31/62 (50%)
Frame = -1

Query: 465 LNAKGDRGVASNESITAQGYFEGKINVWAKKPKVTACMYSPQERSST*ASQAINGIKTTQ 286
LN+ G+ SN++IT Q + IN+W +V MY+P R S I G+ T+
Sbjct: 408 LNSTGNGTEGSNDTITLQCRIKQIINMW---QEVGKAMYAPPIRGQIKCSSNITGLLLTR 464

Query: 285 AG 280
G
Sbjct: 465 DG 466


>tr|B3VFG8|B3VFG8_9HIV1 Envelope glycoprotein OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 866

Score = 33.1 bits (74), Expect = 7.1
Identities = 21/62 (33%), Positives = 31/62 (50%)
Frame = -1

Query: 465 LNAKGDRGVASNESITAQGYFEGKINVWAKKPKVTACMYSPQERSST*ASQAINGIKTTQ 286
LN+ G+ SN++IT Q + IN+W +V MY+P R S I G+ T+
Sbjct: 408 LNSTGNGTEGSNDTITLQCRIKQIINMW---QEVGKAMYAPPIRGQIKCSSNITGLLLTR 464

Query: 285 AG 280
G
Sbjct: 465 DG 466


>tr|B3VFG7|B3VFG7_9HIV1 Envelope glycoprotein OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 869

Score = 33.1 bits (74), Expect = 7.1
Identities = 21/62 (33%), Positives = 31/62 (50%)
Frame = -1

Query: 465 LNAKGDRGVASNESITAQGYFEGKINVWAKKPKVTACMYSPQERSST*ASQAINGIKTTQ 286
LN+ G+ SN++IT Q + IN+W +V MY+P R S I G+ T+
Sbjct: 411 LNSTGNGTEGSNDTITLQCKIKQIINMW---QEVGKAMYAPPIRGQIKCSSNITGLLLTR 467

Query: 285 AG 280
G
Sbjct: 468 DG 469


>tr|Q71846|Q71846_9HIV1 Envelope glycoprotein, V3-V5 region
(Fragment) OS=Human immunodeficiency virus 1 GN=env PE=4
SV=1
Length = 207

Score = 32.7 bits (73), Expect = 9.3
Identities = 20/61 (32%), Positives = 29/61 (47%)
Frame = -1

Query: 462 NAKGDRGVASNESITAQGYFEGKINVWAKKPKVTACMYSPQERSST*ASQAINGIKTTQA 283
N +G SN++IT Q + IN+W +V MY+P R S I G+ T+
Sbjct: 133 NIEGSNSTESNDTITLQCRIKQIINMW---QQVGKAMYAPPIRGPIRCSSNITGLLLTRD 189

Query: 282 G 280
G
Sbjct: 190 G 190


>tr|Q71388|Q71388_9HIV1 Envelope protein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 528

Score = 32.7 bits (73), Expect = 9.3
Identities = 19/61 (31%), Positives = 28/61 (45%)
Frame = -1

Query: 462 NAKGDRGVASNESITAQGYFEGKINVWAKKPKVTACMYSPQERSST*ASQAINGIKTTQA 283
N +G G NE+IT + +N+W +V MY+P R S I G+ T+
Sbjct: 399 NTRGPNGTQGNETITLPCRIKQIVNMW---QEVGKAMYAPPIRGQINCSSLITGLILTRD 455

Query: 282 G 280
G
Sbjct: 456 G 456


>tr|Q2ESM7|Q2ESM7_BACTU Hypothetical conjugation protein OS=Bacillus
thuringiensis GN=pBMB67_049 PE=4 SV=1
Length = 847

Score = 32.7 bits (73), Expect = 9.3
Identities = 18/39 (46%), Positives = 26/39 (66%)
Frame = -1

Query: 480 KHMFSLNAKGDRGVASNESITAQGYFEGKINVWAKKPKV 364
+H+ + A+ RGVAS+ S+ F+ KINVWAKK K+
Sbjct: 639 EHLTEVYARILRGVASDNSL-----FKEKINVWAKKRKL 672