BP913969
Clone id YMU001_000038_D07
Library
Length 440
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000038_D07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCTGCTACAGCAATGGGCTGTGGTGCTGGCCGTAACGTCGCAACTCTAAATGATGTTACC
AACATACTTTTAAGCTCCAATGTTTGTGGTGATTGTTATGTATTTGATGAAGTTCAGGCA
ATCTCGTCACAGCAGTTGACAAAAGTGGGAATACCACAAACTCCGAGTGCCAAGTCAAAC
ATGCCCTTTCACTTAATCACACGTGAGGCAGCAAATCTGCTTTTAAATTCGGCTCAGACC
TCTAGTTGTACATGAAATTGAGCTTTTTTCTGCCACTGGGATGCCATATTGAAGAGGACT
TCTCGCTATAAGGCTTGCTGCAAGCAAGGGCTTTGATGCTGTTGTCATTGACTTGAAACA
GATTTGGAGCACTTGTTTGCAAGAGAGTTGGCCATGTGGCTCGGCAGCAGCATTCACTTC
GTTGGAGAATGTTACCAAGC
■■Homology search results ■■ -
sp_hit_id P58822
Definition sp|P58822|PGIP2_PHAVU Polygalacturonase inhibitor 2 OS=Phaseolus vulgaris
Align length 54
Score (bit) 30.4
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913969|Adiantum capillus-veneris mRNA, clone:
YMU001_000038_D07.
(440 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P58822|PGIP2_PHAVU Polygalacturonase inhibitor 2 OS=Phaseolus... 30 3.4
sp|Q9P225|DYH2_HUMAN Dynein heavy chain 2, axonemal OS=Homo sapi... 30 3.4
sp|Q28651|2A5G_RABIT Serine/threonine-protein phosphatase 2A 56 ... 30 4.4
sp|Q60996|2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 ... 30 4.4
sp|Q13362|2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 30 4.4
sp|Q28653|2A5D_RABIT Serine/threonine-protein phosphatase 2A 56 ... 30 4.4
sp|Q14738|2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 ... 30 4.4
sp|O87389|GLXA_RHIME HTH-type transcriptional regulator glxA OS=... 30 5.7
sp|Q5QVM7|METK_IDILO S-adenosylmethionine synthetase OS=Idiomari... 29 9.8
sp|P03396|ENV_RSVP Envelope glycoprotein gp95 OS=Rous sarcoma vi... 29 9.8

>sp|P58822|PGIP2_PHAVU Polygalacturonase inhibitor 2 OS=Phaseolus
vulgaris GN=PGIP2 PE=1 SV=1
Length = 342

Score = 30.4 bits (67), Expect = 3.4
Identities = 18/54 (33%), Positives = 25/54 (46%)
Frame = -2

Query: 409 CCRATWPTLLQTSAPNLFQVNDNSIKALACSKPYSEKSSSIWHPSGRKKLNFMY 248
CC TW +L + ++VN+ + L KPY SS P LNF+Y
Sbjct: 62 CCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLP----YLNFLY 111


>sp|Q9P225|DYH2_HUMAN Dynein heavy chain 2, axonemal OS=Homo sapiens
GN=DNAH2 PE=1 SV=3
Length = 4427

Score = 30.4 bits (67), Expect = 3.4
Identities = 19/58 (32%), Positives = 29/58 (50%)
Frame = +1

Query: 46 LNDVTNILLSSNVCGDCYVFDEVQAISSQQLTKVGIPQTPSAKSNMPFHLITREAANL 219
L D+ NIL S V + Y DE + I S + + + Q P + ++ +LI R NL
Sbjct: 2830 LEDINNILSSGEV-PNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNL 2886


>sp|Q28651|2A5G_RABIT Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit gamma isoform OS=Oryctolagus
cuniculus GN=PPP2R5C PE=2 SV=1
Length = 524

Score = 30.0 bits (66), Expect = 4.4
Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
Frame = -2

Query: 208 PHV*LSERACLTWHSEFVVFPLLSTAVTRLPELH-QIHNNHHKHWS 74
PH ++ERA W++E+++ + A LP + ++ N HW+
Sbjct: 338 PHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWN 383


>sp|Q60996|2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit gamma isoform OS=Mus musculus
GN=Ppp2r5c PE=1 SV=2
Length = 524

Score = 30.0 bits (66), Expect = 4.4
Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
Frame = -2

Query: 208 PHV*LSERACLTWHSEFVVFPLLSTAVTRLPELH-QIHNNHHKHWS 74
PH ++ERA W++E+++ + A LP + ++ N HW+
Sbjct: 338 PHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWN 383


>sp|Q13362|2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit gamma isoform OS=Homo sapiens
GN=PPP2R5C PE=1 SV=3
Length = 524

Score = 30.0 bits (66), Expect = 4.4
Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
Frame = -2

Query: 208 PHV*LSERACLTWHSEFVVFPLLSTAVTRLPELH-QIHNNHHKHWS 74
PH ++ERA W++E+++ + A LP + ++ N HW+
Sbjct: 338 PHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWN 383


>sp|Q28653|2A5D_RABIT Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit delta isoform OS=Oryctolagus
cuniculus GN=PPP2R5D PE=2 SV=1
Length = 586

Score = 30.0 bits (66), Expect = 4.4
Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
Frame = -2

Query: 208 PHV*LSERACLTWHSEFVVFPLLSTAVTRLPELH-QIHNNHHKHWS 74
PH ++ERA W++E+++ + A LP + ++ N HW+
Sbjct: 398 PHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWN 443


>sp|Q14738|2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa
regulatory subunit delta isoform OS=Homo sapiens
GN=PPP2R5D PE=1 SV=1
Length = 602

Score = 30.0 bits (66), Expect = 4.4
Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
Frame = -2

Query: 208 PHV*LSERACLTWHSEFVVFPLLSTAVTRLPELH-QIHNNHHKHWS 74
PH ++ERA W++E+++ + A LP + ++ N HW+
Sbjct: 414 PHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWN 459


>sp|O87389|GLXA_RHIME HTH-type transcriptional regulator glxA
OS=Rhizobium meliloti GN=glxA PE=4 SV=1
Length = 324

Score = 29.6 bits (65), Expect = 5.7
Identities = 16/47 (34%), Positives = 25/47 (53%)
Frame = -3

Query: 372 VLQICFKSMTTASKPLLAASLIARSPLQYGIPVAEKSSISCTTRGLS 232
V S +A++PL AA+L+A PL +P+A ++ GLS
Sbjct: 18 VRNFALMSYASATEPLRAANLLAGRPLYQIVPLAPGGGTVASSSGLS 64


>sp|Q5QVM7|METK_IDILO S-adenosylmethionine synthetase OS=Idiomarina
loihiensis GN=metK PE=3 SV=1
Length = 381

Score = 28.9 bits (63), Expect = 9.8
Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 2/38 (5%)
Frame = -3

Query: 336 SKPLLAASLIARSPLQ--YGIPVAEKSSISCTTRGLSR 229
+K L+AA L R LQ Y I VAE +SIS T G S+
Sbjct: 283 AKNLVAAGLAERCELQISYAIGVAEPTSISIDTFGTSK 320


>sp|P03396|ENV_RSVP Envelope glycoprotein gp95 OS=Rous sarcoma virus
(strain Prague C) GN=env PE=1 SV=1
Length = 603

Score = 28.9 bits (63), Expect = 9.8
Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%)
Frame = +1

Query: 43 TLNDVTNILLSSNVCGDCYVFDEVQAISSQQLTKVGI-------PQTPSAKSNMPFHLIT 201
+L +VTNI S V G C F +K G+ P T ++ S PF ++T
Sbjct: 178 SLPNVTNITQVSGVAGGCVYFAPRATGLFLGWSKQGLSRFLLRHPFTSTSNSTEPFTVVT 237

Query: 202 REAANLLLNS 231
+ NL + S
Sbjct: 238 ADRHNLFMGS 247


tr_hit_id A5AJ59
Definition tr|A5AJ59|A5AJ59_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 68
Score (bit) 45.1
E-value 0.002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913969|Adiantum capillus-veneris mRNA, clone:
YMU001_000038_D07.
(440 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5AJ59|A5AJ59_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A7PUN9|A7PUN9_VITVI Chromosome chr7 scaffold_31, whole genome... 45 0.002
tr|Q8S5U3|Q8S5U3_ORYSJ Os03g0164700 protein OS=Oryza sativa subs... 40 0.058
tr|A3AEG1|A3AEG1_ORYSJ Putative uncharacterized protein OS=Oryza... 40 0.058
tr|A2XCW1|A2XCW1_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.058
tr|Q9ASV2|Q9ASV2_ARATH At1g06730/F4H5_22 OS=Arabidopsis thaliana... 40 0.075
tr|B4FCP5|B4FCP5_MAIZE Putative uncharacterized protein OS=Zea m... 36 0.83
tr|B5YJH5|B5YJH5_THEYD tRNA pseudouridine synthase D OS=Thermode... 36 1.1
tr|B6SW58|B6SW58_MAIZE Protein kinase OS=Zea mays PE=2 SV=1 36 1.1
tr|B4QYI7|B4QYI7_DROSI GD19016 OS=Drosophila simulans GN=GD19016... 33 7.0
tr|Q5K252|Q5K252_GUITH Putative regulatory subunit of protein ph... 33 9.2
tr|B7FRM7|B7FRM7_PHATR Predicted protein OS=Phaeodactylum tricor... 33 9.2

>tr|A5AJ59|A5AJ59_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031405 PE=4 SV=1
Length = 1456

Score = 45.1 bits (105), Expect = 0.002
Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 2/68 (2%)
Frame = +1

Query: 1 AATAMGCGAGRNVATLNDVTNILLSSNVCGDCYVFDEV--QAISSQQLTKVGIPQTPSAK 174
AATAMGCGAGRNVA L V ++ +SN+ D ++E+ + +QQ+T + +T
Sbjct: 1367 AATAMGCGAGRNVANLEQVIELMRASNLNEDATFWNELLDDNLDAQQIT--FLSKTAXNG 1424

Query: 175 SNMPFHLI 198
SN H +
Sbjct: 1425 SNNQLHRV 1432


>tr|A7PUN9|A7PUN9_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023875001
PE=4 SV=1
Length = 459

Score = 44.7 bits (104), Expect = 0.002
Identities = 23/49 (46%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
Frame = +1

Query: 1 AATAMGCGAGRNVATLNDVTNILLSSNVCGDCYVFDEV--QAISSQQLT 141
AATAMGCGAGRNVA L V ++ +SN+ D ++E+ + +QQ+T
Sbjct: 370 AATAMGCGAGRNVANLEQVIELMRASNLNEDATFWNELLDDNLDAQQIT 418


>tr|Q8S5U3|Q8S5U3_ORYSJ Os03g0164700 protein OS=Oryza sativa subsp.
japonica GN=OJ1123F12.7 PE=4 SV=1
Length = 470

Score = 40.0 bits (92), Expect = 0.058
Identities = 22/43 (51%), Positives = 27/43 (62%)
Frame = +1

Query: 1 AATAMGCGAGRNVATLNDVTNILLSSNVCGDCYVFDEVQAISS 129
AATA GCGAGRNVA L+ V +L SN+ D + E+ SS
Sbjct: 381 AATATGCGAGRNVAHLDKVLQLLRESNINEDDTPWSELIEASS 423


>tr|A3AEG1|A3AEG1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009183 PE=4 SV=1
Length = 466

Score = 40.0 bits (92), Expect = 0.058
Identities = 22/43 (51%), Positives = 27/43 (62%)
Frame = +1

Query: 1 AATAMGCGAGRNVATLNDVTNILLSSNVCGDCYVFDEVQAISS 129
AATA GCGAGRNVA L+ V +L SN+ D + E+ SS
Sbjct: 377 AATATGCGAGRNVAHLDKVLQLLRESNINEDDTPWSELIEASS 419


>tr|A2XCW1|A2XCW1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10145 PE=4 SV=1
Length = 470

Score = 40.0 bits (92), Expect = 0.058
Identities = 22/43 (51%), Positives = 27/43 (62%)
Frame = +1

Query: 1 AATAMGCGAGRNVATLNDVTNILLSSNVCGDCYVFDEVQAISS 129
AATA GCGAGRNVA L+ V +L SN+ D + E+ SS
Sbjct: 381 AATATGCGAGRNVAHLDKVLQLLRESNINEDDTPWSELIEASS 423


>tr|Q9ASV2|Q9ASV2_ARATH At1g06730/F4H5_22 OS=Arabidopsis thaliana
GN=At1g06730 PE=2 SV=1
Length = 488

Score = 39.7 bits (91), Expect = 0.075
Identities = 19/44 (43%), Positives = 31/44 (70%)
Frame = +1

Query: 1 AATAMGCGAGRNVATLNDVTNILLSSNVCGDCYVFDEVQAISSQ 132
AATAMGCGAGRNVA + V +++ +S + + F+++ A +S+
Sbjct: 396 AATAMGCGAGRNVAKRHQVVDLMKASKLNDEEKFFEQLLAENSE 439


>tr|B4FCP5|B4FCP5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 149

Score = 36.2 bits (82), Expect = 0.83
Identities = 17/38 (44%), Positives = 26/38 (68%)
Frame = +1

Query: 1 AATAMGCGAGRNVATLNDVTNILLSSNVCGDCYVFDEV 114
AATA GCGAGRNVA L+ V ++ +++ D ++ E+
Sbjct: 60 AATATGCGAGRNVARLDKVLQLMREADLNEDITLWTEL 97


>tr|B5YJH5|B5YJH5_THEYD tRNA pseudouridine synthase D
OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 /
DSM 11347 / YP87) GN=truD PE=4 SV=1
Length = 390

Score = 35.8 bits (81), Expect = 1.1
Identities = 20/58 (34%), Positives = 32/58 (55%)
Frame = +1

Query: 31 RNVATLNDVTNILLSSNVCGDCYVFDEVQAISSQQLTKVGIPQTPSAKSNMPFHLITR 204
R + TL V N+L+ V G+ FDE+ + + L + IP TPS+ + MP +I +
Sbjct: 256 RLLKTLFPVENLLIHKGVAGEYIFFDEIDEKNFEYLKSLEIP-TPSSNAKMPQDIIEK 312


>tr|B6SW58|B6SW58_MAIZE Protein kinase OS=Zea mays PE=2 SV=1
Length = 480

Score = 35.8 bits (81), Expect = 1.1
Identities = 17/38 (44%), Positives = 26/38 (68%)
Frame = +1

Query: 1 AATAMGCGAGRNVATLNDVTNILLSSNVCGDCYVFDEV 114
AATA GCGAGRNVA L+ V ++ +++ D ++ E+
Sbjct: 391 AATATGCGAGRNVARLDKVLQLVREADLNEDVTLWTEL 428


>tr|B4QYI7|B4QYI7_DROSI GD19016 OS=Drosophila simulans GN=GD19016
PE=4 SV=1
Length = 365

Score = 33.1 bits (74), Expect = 7.0
Identities = 25/113 (22%), Positives = 44/113 (38%), Gaps = 7/113 (6%)
Frame = -2

Query: 397 TWPTLLQTSAPNLFQVNDNSIKALACSKPYSEKSSSIWHPSGRKKLNFMYN*R------- 239
T T+ +TS V DN C+K + ++ +H + L +N +
Sbjct: 54 TQETIARTSTDKRISVTDNGYHCTVCNKDFRSRTQQYYHLTCGNDLLKKFNCKECGRRFA 113

Query: 238 SEPNLKADLLPHV*LSERACLTWHSEFVVFPLLSTAVTRLPELHQIHNNHHKH 80
+ +LK L+ H S+ +C H F +L + H + +N KH
Sbjct: 114 TSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVL--------QRHMLTHNQEKH 158