BP913976
Clone id YMU001_000038_E02
Library
Length 564
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000038_E02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GACGTGCCAATGGACAAGGGAGGCTAGCGAAGCGACCCACAGGTCCCATGGCACAAGGAA
AGAAGGAAAAGGGATTTAGTTGGTAGATTAGAGAATTCCCAAGATCCAGATTGAGGTGCC
AAGGACAGGGAGGCCAGAAGGGCTACCATAGGTAAAAGAGCACAAGGTAAGAACAGAAAG
GTAAGCTAGGTCCACTGGATAATTTGGTCAAGGATACTTTTTGGCCCTTGATGCAAAATG
GATGAAGAAAGGGAACCTTGCAAATTCTCTTCAGAGAGAGCTATACCTTGAAGCTTTTGG
GCTGATAGTAGTATCTATGTCAAAGCAAGGTTGAATTTGGTGCTGTGTGGACTTCGGAAG
AGGGGAGCCACTCGACTCCTTTGTCACAGATTGCCTAGATTGAATAAAGTCACTAATTTC
TCTTTGAGATTTTAGGGTATTGACGGATTGAGAGTATTTTGCGGAATGACTTTATGAACC
GTGTGCACTGAATTGGAAATTTCCTTGATTGAAGTGAAAACATTTGCTCTTTTATGTGTG
TATTGTTAGAGACATGTAGAGAAA
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913976|Adiantum capillus-veneris mRNA, clone:
YMU001_000038_E02.
(564 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A2D8Q2
Definition tr|A2D8Q2|A2D8Q2_TRIVA Putative uncharacterized protein OS=Trichomonas vaginalis G3
Align length 117
Score (bit) 33.9
E-value 6.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913976|Adiantum capillus-veneris mRNA, clone:
YMU001_000038_E02.
(564 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2D8Q2|A2D8Q2_TRIVA Putative uncharacterized protein OS=Trich... 34 6.3

>tr|A2D8Q2|A2D8Q2_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_186090 PE=4 SV=1
Length = 285

Score = 33.9 bits (76), Expect = 6.3
Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 2/117 (1%)
Frame = -3

Query: 493 IQCTRFIKSFRKILSIRQY--PKISKRN**LYSI*AICDKGVEWLPSSEVHTAPNSTLL* 320
I+ TRF+ + R S R + PK+ + Y++ DKG +W+ + P ++
Sbjct: 106 IKPTRFVLADRPPKSGRNFENPKLMLKYLNDYTV---IDKGCKWVRDDKFFGVPVEQIV- 161

Query: 319 HRYYYQPKSFKV*LSLKRICKVPFLHPFCIKGQKVSLTKLSSGPSLPFCSYLVLFYL 149
Y+Q V L I F+H C G + + ++ GP+L C++L +F +
Sbjct: 162 --KYWQSIKVLVTLQGSGIYNAIFMHEKC--GMCLVFSSINDGPNLHLCTHLHIFLI 214