BP913983
Clone id YMU001_000038_E10
Library
Length 555
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000038_E10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTCGCTTTTGTATGCTCCTCTCATTTGCAACCAAATTGTGACAATATTTGCTTCTCTTT
TCACTTAGGGGAGCACTCTCATCATTCCGAAAGAAACAAAAAAGCTTTGACACTTGGGCA
TCCTCTGATGGACATTGTAGCATGGTTTCCATCATTTCATACACCTCAGACAACTGTTCT
AGCTCTTCTGCAGTCATGTCCTTACGACAGGCTGAAGTGACAAAATTCTTGCACTCCAAA
AACTGGGCAGAGACAAGTTCTCCCTTCATTGCCATGGATGATTCCGCAATAGCAAATCCT
GTCCCCAGTATGGCTATGAATAGCTGCTCAAAAAGGGATGCTGGCGAGATATCCTCCAGT
TCATTCAACGTGCTCTCTACTGCGAGCTCTTCATCAAACAATGGAGCCTGCCTTGCCGCA
GGAATCGGCCTTGCTGATGACCAGAGCTCCTGCCAAAGGTTACCTTGTGACTGCATTCTT
GCACTCAAATAACCTCGACACTCTGTTCCATGCTTGGTTTCTTTCGCTGAGGACTCCAAG
CAATGGCTTTGTCTC
■■Homology search results ■■ -
sp_hit_id P69735
Definition sp|P69735|RB3GP_RAT Rab3 GTPase-activating protein catalytic subunit (Fragments) OS=Rattus norvegicus
Align length 78
Score (bit) 57.4
E-value 5.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913983|Adiantum capillus-veneris mRNA, clone:
YMU001_000038_E10.
(555 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P69735|RB3GP_RAT Rab3 GTPase-activating protein catalytic sub... 57 5e-08
sp|Q80UJ7|RB3GP_MOUSE Rab3 GTPase-activating protein catalytic s... 57 5e-08
sp|Q15042|RB3GP_HUMAN Rab3 GTPase-activating protein catalytic s... 57 6e-08
sp|Q642R9|RB3GP_XENLA Rab3 GTPase-activating protein catalytic s... 57 8e-08
sp|Q6NUV0|RB3GP_DANRE Rab3 GTPase-activating protein catalytic s... 56 1e-07
sp|Q9VQ26|RB3GP_DROME Rab3 GTPase-activating protein catalytic s... 46 1e-04
sp|Q75JC9|Y8484_DICDI Uncharacterized protein DDB_G0271670 OS=Di... 39 0.013
sp|O42970|YB95_SCHPO Uncharacterized serine-rich protein C1E8.05... 37 0.065
sp|Q93538|RB3GP_CAEEL Rab3 GTPase-activating protein catalytic s... 37 0.084
sp|Q17RH7|TPRXL_HUMAN Putative protein TPRXL OS=Homo sapiens GN=... 35 0.25
sp|Q6FT26|DSE2_CANGA Protein DSE2 OS=Candida glabrata GN=DSE2 PE... 35 0.25
sp|A1T065|RPOB_PSYIN DNA-directed RNA polymerase subunit beta OS... 34 0.55
sp|Q8TFG9|YL61_SCHPO Uncharacterized serine/threonine-rich prote... 34 0.55
sp|O13695|YEN1_SCHPO Uncharacterized serine-rich protein C11G7.0... 33 0.72
sp|P40472|SIM1_YEAST Protein SIM1 OS=Saccharomyces cerevisiae GN... 33 0.72
sp|O33915|CISY_RHIME Citrate synthase OS=Rhizobium meliloti GN=g... 33 0.72
sp|P51038|CISY2_RHITR Citrate synthase, plasmid OS=Rhizobium tro... 33 0.72
sp|P51037|CISY1_RHITR Citrate synthase, chromosomal OS=Rhizobium... 33 0.72
sp|Q6B926|CCS1_GRATL Cytochrome c biogenesis protein ccs1 OS=Gra... 33 0.72
sp|Q9D952|EVPL_MOUSE Envoplakin OS=Mus musculus GN=Evpl PE=2 SV=2 33 0.93
sp|Q54VY0|Y6358_DICDI Putative uncharacterized protein DDB_G0280... 33 0.94
sp|P87179|WSC1_SCHPO Cell wall integrity and stress response com... 33 1.2
sp|Q08831|VTS1_YEAST Protein VTS1 OS=Saccharomyces cerevisiae GN... 33 1.2
sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein ... 33 1.2
sp|Q9P7X4|YH6B_SCHPO Uncharacterized serine-rich protein P23A10.... 32 1.6
sp|P54674|PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyos... 32 1.6
sp|P39734|HPH2_YEAST Protein HPH2 OS=Saccharomyces cerevisiae GN... 32 1.6
sp|Q889X8|RPOB_PSESM DNA-directed RNA polymerase subunit beta OS... 32 2.1
sp|P79942|NOCT_XENLA Nocturnin OS=Xenopus laevis GN=ccrn4l PE=2 ... 32 2.1
sp|Q04893|YM96_YEAST Uncharacterized protein YMR317W OS=Saccharo... 32 2.1

>sp|P69735|RB3GP_RAT Rab3 GTPase-activating protein catalytic
subunit (Fragments) OS=Rattus norvegicus GN=Rab3gap1
PE=1 SV=2
Length = 775

Score = 57.4 bits (137), Expect = 5e-08
Identities = 28/78 (35%), Positives = 40/78 (51%)
Frame = -2

Query: 539 LESSAKETKHGTECRGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNE 360
+E + K +G LSARM+ N+W E W +A+P+PA RQ LFD+ E L+
Sbjct: 502 IEEEVTDEKGNVVLKGELSARMKIPSNMWVEAWETAKPVPARRQRRLFDDTREAEKVLHY 561

Query: 359 LEDISPASLFEQLFIAIL 306
L PA L L ++
Sbjct: 562 LAMQKPADLARHLLPCVI 579


>sp|Q80UJ7|RB3GP_MOUSE Rab3 GTPase-activating protein catalytic
subunit OS=Mus musculus GN=Rab3gap1 PE=2 SV=3
Length = 981

Score = 57.4 bits (137), Expect = 5e-08
Identities = 28/78 (35%), Positives = 40/78 (51%)
Frame = -2

Query: 539 LESSAKETKHGTECRGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNE 360
+E + K +G LSARM+ N+W E W +A+P+PA RQ LFD+ E L+
Sbjct: 708 IEEEVTDEKGNVVLKGELSARMKIPSNMWVEAWETAKPVPARRQRRLFDDTREAEKVLHY 767

Query: 359 LEDISPASLFEQLFIAIL 306
L PA L L ++
Sbjct: 768 LAMQKPADLARHLLPCVI 785


>sp|Q15042|RB3GP_HUMAN Rab3 GTPase-activating protein catalytic
subunit OS=Homo sapiens GN=RAB3GAP1 PE=1 SV=3
Length = 981

Score = 57.0 bits (136), Expect = 6e-08
Identities = 29/78 (37%), Positives = 40/78 (51%)
Frame = -2

Query: 539 LESSAKETKHGTECRGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNE 360
+E + K +G LSARM+ N+W E W +A+PIPA RQ LFD+ E L+
Sbjct: 708 IEEEVIDEKGNVVLKGELSARMKIPSNMWVEAWETAKPIPARRQRRLFDDTREAEKVLHY 767

Query: 359 LEDISPASLFEQLFIAIL 306
L PA L L ++
Sbjct: 768 LAIQKPADLARHLLPCVI 785


>sp|Q642R9|RB3GP_XENLA Rab3 GTPase-activating protein catalytic
subunit OS=Xenopus laevis GN=rab3gap1 PE=2 SV=1
Length = 978

Score = 56.6 bits (135), Expect = 8e-08
Identities = 29/78 (37%), Positives = 40/78 (51%)
Frame = -2

Query: 539 LESSAKETKHGTECRGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNE 360
+E + K +G LSARM+ N+W E W +A+PIPA RQ LFD+ E L+
Sbjct: 707 IEEEVMDDKGNKIFKGELSARMKIPNNMWVEAWETAKPIPARRQRRLFDDTKEAEKVLHY 766

Query: 359 LEDISPASLFEQLFIAIL 306
L PA L L ++
Sbjct: 767 LAVQKPADLTRHLLPCVI 784


>sp|Q6NUV0|RB3GP_DANRE Rab3 GTPase-activating protein catalytic
subunit OS=Danio rerio GN=rab3gap1 PE=2 SV=2
Length = 969

Score = 56.2 bits (134), Expect = 1e-07
Identities = 30/78 (38%), Positives = 39/78 (50%)
Frame = -2

Query: 539 LESSAKETKHGTECRGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNE 360
+E + E RG LSARM+ GN+W E W +AR PA RQ LFD+ E L+
Sbjct: 696 VEEQVTDADGRVEVRGELSARMKIPGNMWVEAWETARATPARRQKRLFDDTKEAEKVLHY 755

Query: 359 LEDISPASLFEQLFIAIL 306
L P+ L L +L
Sbjct: 756 LALQKPSELTRHLLPCVL 773


>sp|Q9VQ26|RB3GP_DROME Rab3 GTPase-activating protein catalytic
subunit OS=Drosophila melanogaster GN=CG31935 PE=1 SV=2
Length = 916

Score = 46.2 bits (108), Expect = 1e-04
Identities = 26/118 (22%), Positives = 56/118 (47%)
Frame = -2

Query: 488 LSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNELEDISPASLFEQLFIAI 309
LS RM ++GN WQ++W A+ +P +RQ LFD+ L+ LE ++ I +
Sbjct: 682 LSIRMTTEGNTWQKVWEQAQAVPVSRQKRLFDDTNEALKVLHYLETRKMHEIYNLTVIPL 741

Query: 308 LGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRKDMTAEELEQLSEVYEMMETMLQ 135
L + + + + EL + + ++ CR ++ ++L + +++ + +
Sbjct: 742 LHSAI-LKLADILSNAELEDLFSSQIEKLLSDLCR--LSRSHSDELPSIKPLLDDLAE 796


>sp|Q75JC9|Y8484_DICDI Uncharacterized protein DDB_G0271670
OS=Dictyostelium discoideum GN=DDB_G0271670 PE=4 SV=1
Length = 374

Score = 39.3 bits (90), Expect = 0.013
Identities = 33/135 (24%), Positives = 62/135 (45%)
Frame = +1

Query: 46 YLLLFSLRGALSSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTK 225
+L + + SS S + +SS S S S +S + SSSS+ S + +
Sbjct: 59 FLNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

Query: 226 FLHSKNWAETSSPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNG 405
S + + +SS + S+ ++ S + +S S + SSSS + S++SSSS++
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

Query: 406 ACLAAGIGLADDQSS 450
+ ++ + SS
Sbjct: 179 SSSSSSSSSSSSSSS 193



Score = 38.5 bits (88), Expect = 0.022
Identities = 31/115 (26%), Positives = 56/115 (48%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 258 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 317

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAG 423
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++G
Sbjct: 318 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSG 372



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 71 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 130

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 190

Query: 439 DQSS 450
SS
Sbjct: 191 SSSS 194



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 72 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 131

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 191

Query: 439 DQSS 450
SS
Sbjct: 192 SSSS 195



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 73 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 132

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 192

Query: 439 DQSS 450
SS
Sbjct: 193 SSSS 196



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 74 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 133

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 193

Query: 439 DQSS 450
SS
Sbjct: 194 SSSS 197



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 75 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

Query: 439 DQSS 450
SS
Sbjct: 195 SSSS 198



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 76 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 135

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 195

Query: 439 DQSS 450
SS
Sbjct: 196 SSSS 199



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 77 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 136

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 196

Query: 439 DQSS 450
SS
Sbjct: 197 SSSS 200



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 78 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 137

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 138 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 197

Query: 439 DQSS 450
SS
Sbjct: 198 SSSS 201



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 79 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 138

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 139 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 198

Query: 439 DQSS 450
SS
Sbjct: 199 SSSS 202



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 80 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 139

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 140 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199

Query: 439 DQSS 450
SS
Sbjct: 200 SSSS 203



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 81 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 140

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 141 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

Query: 439 DQSS 450
SS
Sbjct: 201 SSSS 204



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 82 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 141

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

Query: 439 DQSS 450
SS
Sbjct: 202 SSSS 205



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 83 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 142

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

Query: 439 DQSS 450
SS
Sbjct: 203 SSSS 206



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 84 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 143

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

Query: 439 DQSS 450
SS
Sbjct: 204 SSSS 207



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 85 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 144

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

Query: 439 DQSS 450
SS
Sbjct: 205 SSSS 208



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 86 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 145

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 146 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

Query: 439 DQSS 450
SS
Sbjct: 206 SSSS 209



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 87 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 146

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

Query: 439 DQSS 450
SS
Sbjct: 207 SSSS 210



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 88 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 147

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 148 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 207

Query: 439 DQSS 450
SS
Sbjct: 208 SSSS 211



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 89 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 148

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

Query: 439 DQSS 450
SS
Sbjct: 209 SSSS 212



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 90 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 149

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

Query: 439 DQSS 450
SS
Sbjct: 210 SSSS 213



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 91 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 150

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 210

Query: 439 DQSS 450
SS
Sbjct: 211 SSSS 214



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 92 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 151

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 152 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

Query: 439 DQSS 450
SS
Sbjct: 212 SSSS 215



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 93 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 152

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

Query: 439 DQSS 450
SS
Sbjct: 213 SSSS 216



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 94 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 153

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 154 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

Query: 439 DQSS 450
SS
Sbjct: 214 SSSS 217



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 95 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 154

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 155 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

Query: 439 DQSS 450
SS
Sbjct: 215 SSSS 218



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 96 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 155

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 156 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

Query: 439 DQSS 450
SS
Sbjct: 216 SSSS 219



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 97 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 156

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 157 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

Query: 439 DQSS 450
SS
Sbjct: 217 SSSS 220



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 98 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 157

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 158 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

Query: 439 DQSS 450
SS
Sbjct: 218 SSSS 221



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 99 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 158

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 159 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

Query: 439 DQSS 450
SS
Sbjct: 219 SSSS 222



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 100 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 159

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 160 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 219

Query: 439 DQSS 450
SS
Sbjct: 220 SSSS 223



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 101 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 160

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 161 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

Query: 439 DQSS 450
SS
Sbjct: 221 SSSS 224



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 102 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 221

Query: 439 DQSS 450
SS
Sbjct: 222 SSSS 225



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 103 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 162

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 222

Query: 439 DQSS 450
SS
Sbjct: 223 SSSS 226



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 104 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 163

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 164 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 223

Query: 439 DQSS 450
SS
Sbjct: 224 SSSS 227



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 105 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 164

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 165 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 224

Query: 439 DQSS 450
SS
Sbjct: 225 SSSS 228



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 106 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 165

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 225

Query: 439 DQSS 450
SS
Sbjct: 226 SSSS 229



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 107 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 166

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 167 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 226

Query: 439 DQSS 450
SS
Sbjct: 227 SSSS 230



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 108 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 167

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 168 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 227

Query: 439 DQSS 450
SS
Sbjct: 228 SSSS 231



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 109 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 168

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 169 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 228

Query: 439 DQSS 450
SS
Sbjct: 229 SSSS 232



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 169

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 170 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 229

Query: 439 DQSS 450
SS
Sbjct: 230 SSSS 233



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 111 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 170

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 230

Query: 439 DQSS 450
SS
Sbjct: 231 SSSS 234



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 112 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 171

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 172 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 231

Query: 439 DQSS 450
SS
Sbjct: 232 SSSS 235



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 173 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 232

Query: 439 DQSS 450
SS
Sbjct: 233 SSSS 236



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 114 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 173

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 174 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 233

Query: 439 DQSS 450
SS
Sbjct: 234 SSSS 237



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 175 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 234

Query: 439 DQSS 450
SS
Sbjct: 235 SSSS 238



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 116 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 175

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 176 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 235

Query: 439 DQSS 450
SS
Sbjct: 236 SSSS 239



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 117 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 176

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 177 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 236

Query: 439 DQSS 450
SS
Sbjct: 237 SSSS 240



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 237

Query: 439 DQSS 450
SS
Sbjct: 238 SSSS 241



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 119 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 178

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

Query: 439 DQSS 450
SS
Sbjct: 239 SSSS 242



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 120 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 179

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

Query: 439 DQSS 450
SS
Sbjct: 240 SSSS 243



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 121 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 180

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 181 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 240

Query: 439 DQSS 450
SS
Sbjct: 241 SSSS 244



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 122 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 181

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 241

Query: 439 DQSS 450
SS
Sbjct: 242 SSSS 245



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 123 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 182

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

Query: 439 DQSS 450
SS
Sbjct: 243 SSSS 246



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 124 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 183

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 184 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 243

Query: 439 DQSS 450
SS
Sbjct: 244 SSSS 247



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 184

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 185 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 244

Query: 439 DQSS 450
SS
Sbjct: 245 SSSS 248



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 126 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 185

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 245

Query: 439 DQSS 450
SS
Sbjct: 246 SSSS 249



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 127 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 186

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 246

Query: 439 DQSS 450
SS
Sbjct: 247 SSSS 250



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 128 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 187

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 247

Query: 439 DQSS 450
SS
Sbjct: 248 SSSS 251



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 129 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 188

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 189 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 248

Query: 439 DQSS 450
SS
Sbjct: 249 SSSS 252



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 130 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 189

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 249

Query: 439 DQSS 450
SS
Sbjct: 250 SSSS 253



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 131 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 190

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 250

Query: 439 DQSS 450
SS
Sbjct: 251 SSSS 254



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 132 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 191

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 251

Query: 439 DQSS 450
SS
Sbjct: 252 SSSS 255



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 133 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 192

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 193 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 252

Query: 439 DQSS 450
SS
Sbjct: 253 SSSS 256



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 134 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 193

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 194 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 253

Query: 439 DQSS 450
SS
Sbjct: 254 SSSS 257



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 135 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 194

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 254

Query: 439 DQSS 450
SS
Sbjct: 255 SSSS 258



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 136 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 195

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 255

Query: 439 DQSS 450
SS
Sbjct: 256 SSSS 259



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 137 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 196

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 197 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 256

Query: 439 DQSS 450
SS
Sbjct: 257 SSSS 260



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 138 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 197

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 198 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 257

Query: 439 DQSS 450
SS
Sbjct: 258 SSSS 261



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 139 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 198

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 199 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 258

Query: 439 DQSS 450
SS
Sbjct: 259 SSSS 262



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 140 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 200 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 259

Query: 439 DQSS 450
SS
Sbjct: 260 SSSS 263



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 141 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 200

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 201 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 260

Query: 439 DQSS 450
SS
Sbjct: 261 SSSS 264



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 202 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 261

Query: 439 DQSS 450
SS
Sbjct: 262 SSSS 265



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 143 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 202

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 203 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 262

Query: 439 DQSS 450
SS
Sbjct: 263 SSSS 266



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 144 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 203

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 204 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 263

Query: 439 DQSS 450
SS
Sbjct: 264 SSSS 267



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 145 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 204

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 205 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 264

Query: 439 DQSS 450
SS
Sbjct: 265 SSSS 268



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 146 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 205

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 206 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 265

Query: 439 DQSS 450
SS
Sbjct: 266 SSSS 269



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 147 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 206

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 207 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 266

Query: 439 DQSS 450
SS
Sbjct: 267 SSSS 270



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 148 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 207

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 208 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 267

Query: 439 DQSS 450
SS
Sbjct: 268 SSSS 271



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 149 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 209 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 268

Query: 439 DQSS 450
SS
Sbjct: 269 SSSS 272



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 150 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 209

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 210 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 269

Query: 439 DQSS 450
SS
Sbjct: 270 SSSS 273



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 151 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 210

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 211 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 270

Query: 439 DQSS 450
SS
Sbjct: 271 SSSS 274



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 152 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 211

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 212 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 271

Query: 439 DQSS 450
SS
Sbjct: 272 SSSS 275



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 153 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 213 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 272

Query: 439 DQSS 450
SS
Sbjct: 273 SSSS 276



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 154 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 214 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 273

Query: 439 DQSS 450
SS
Sbjct: 274 SSSS 277



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 155 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 214

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 215 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 274

Query: 439 DQSS 450
SS
Sbjct: 275 SSSS 278



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 156 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 215

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 216 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 275

Query: 439 DQSS 450
SS
Sbjct: 276 SSSS 279



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 157 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 217 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 276

Query: 439 DQSS 450
SS
Sbjct: 277 SSSS 280



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 158 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 217

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 218 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 277

Query: 439 DQSS 450
SS
Sbjct: 278 SSSS 281



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 159 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 219 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 278

Query: 439 DQSS 450
SS
Sbjct: 279 SSSS 282



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 160 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 219

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 220 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 279

Query: 439 DQSS 450
SS
Sbjct: 280 SSSS 283



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 161 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 221 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 280

Query: 439 DQSS 450
SS
Sbjct: 281 SSSS 284



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 221

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 222 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 281

Query: 439 DQSS 450
SS
Sbjct: 282 SSSS 285



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 163 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 222

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 223 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 282

Query: 439 DQSS 450
SS
Sbjct: 283 SSSS 286



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 164 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 223

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 224 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 283

Query: 439 DQSS 450
SS
Sbjct: 284 SSSS 287



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 165 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 224

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 225 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 284

Query: 439 DQSS 450
SS
Sbjct: 285 SSSS 288



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 166 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 225

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 226 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 285

Query: 439 DQSS 450
SS
Sbjct: 286 SSSS 289



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 167 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 226

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 227 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 286

Query: 439 DQSS 450
SS
Sbjct: 287 SSSS 290



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 168 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 227

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 228 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 287

Query: 439 DQSS 450
SS
Sbjct: 288 SSSS 291



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 169 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 228

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 229 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 288

Query: 439 DQSS 450
SS
Sbjct: 289 SSSS 292



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 170 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 229

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 230 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 289

Query: 439 DQSS 450
SS
Sbjct: 290 SSSS 293



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 171 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 230

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 231 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 290

Query: 439 DQSS 450
SS
Sbjct: 291 SSSS 294



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 172 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 231

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 232 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 291

Query: 439 DQSS 450
SS
Sbjct: 292 SSSS 295



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 173 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 232

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 233 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 292

Query: 439 DQSS 450
SS
Sbjct: 293 SSSS 296



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 174 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 233

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 234 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 293

Query: 439 DQSS 450
SS
Sbjct: 294 SSSS 297



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 175 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 234

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 235 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 294

Query: 439 DQSS 450
SS
Sbjct: 295 SSSS 298



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 176 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 235

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 236 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 295

Query: 439 DQSS 450
SS
Sbjct: 296 SSSS 299



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 177 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 236

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 237 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 296

Query: 439 DQSS 450
SS
Sbjct: 297 SSSS 300



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 178 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 237

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 238 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 297

Query: 439 DQSS 450
SS
Sbjct: 298 SSSS 301



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 179 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 238

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 239 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 298

Query: 439 DQSS 450
SS
Sbjct: 299 SSSS 302



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 240 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 299

Query: 439 DQSS 450
SS
Sbjct: 300 SSSS 303



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 181 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 240

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 241 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 300

Query: 439 DQSS 450
SS
Sbjct: 301 SSSS 304



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 182 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 241

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 242 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 301

Query: 439 DQSS 450
SS
Sbjct: 302 SSSS 305



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 243 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 302

Query: 439 DQSS 450
SS
Sbjct: 303 SSSS 306



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 184 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 243

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 244 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 303

Query: 439 DQSS 450
SS
Sbjct: 304 SSSS 307



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 185 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 244

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 245 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 304

Query: 439 DQSS 450
SS
Sbjct: 305 SSSS 308



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 245

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 246 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 305

Query: 439 DQSS 450
SS
Sbjct: 306 SSSS 309



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 246

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 247 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 306

Query: 439 DQSS 450
SS
Sbjct: 307 SSSS 310



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 247

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 248 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 307

Query: 439 DQSS 450
SS
Sbjct: 308 SSSS 311



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 189 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 248

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 249 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 308

Query: 439 DQSS 450
SS
Sbjct: 309 SSSS 312



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 190 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 249

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 250 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 309

Query: 439 DQSS 450
SS
Sbjct: 310 SSSS 313



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 191 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 250

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 251 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 310

Query: 439 DQSS 450
SS
Sbjct: 311 SSSS 314



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 192 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 251

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 252 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 311

Query: 439 DQSS 450
SS
Sbjct: 312 SSSS 315



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 193 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 252

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 253 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 312

Query: 439 DQSS 450
SS
Sbjct: 313 SSSS 316



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 194 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 253

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 254 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 313

Query: 439 DQSS 450
SS
Sbjct: 314 SSSS 317



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 195 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 254

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 255 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 314

Query: 439 DQSS 450
SS
Sbjct: 315 SSSS 318



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 255

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 256 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 315

Query: 439 DQSS 450
SS
Sbjct: 316 SSSS 319



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 197 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 256

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 257 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 316

Query: 439 DQSS 450
SS
Sbjct: 317 SSSS 320



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 198 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 257

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 258 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 317

Query: 439 DQSS 450
SS
Sbjct: 318 SSSS 321



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 199 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 258

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 259 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 318

Query: 439 DQSS 450
SS
Sbjct: 319 SSSS 322



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 200 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 259

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 260 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 319

Query: 439 DQSS 450
SS
Sbjct: 320 SSSS 323



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 201 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 260

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 261 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 320

Query: 439 DQSS 450
SS
Sbjct: 321 SSSS 324



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 202 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 261

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 262 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 321

Query: 439 DQSS 450
SS
Sbjct: 322 SSSS 325



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 203 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 262

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 263 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 322

Query: 439 DQSS 450
SS
Sbjct: 323 SSSS 326



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 204 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 263

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 264 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 323

Query: 439 DQSS 450
SS
Sbjct: 324 SSSS 327



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 205 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 264

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 265 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 324

Query: 439 DQSS 450
SS
Sbjct: 325 SSSS 328



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 206 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 265

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 266 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 325

Query: 439 DQSS 450
SS
Sbjct: 326 SSSS 329



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 207 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 266

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 267 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 326

Query: 439 DQSS 450
SS
Sbjct: 327 SSSS 330



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 208 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 267

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 268 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 327

Query: 439 DQSS 450
SS
Sbjct: 328 SSSS 331



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 209 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 268

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 269 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 328

Query: 439 DQSS 450
SS
Sbjct: 329 SSSS 332



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 210 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 269

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 270 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 329

Query: 439 DQSS 450
SS
Sbjct: 330 SSSS 333



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 211 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 270

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 271 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 330

Query: 439 DQSS 450
SS
Sbjct: 331 SSSS 334



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 212 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 271

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 272 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 331

Query: 439 DQSS 450
SS
Sbjct: 332 SSSS 335



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 213 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 272

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 273 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 332

Query: 439 DQSS 450
SS
Sbjct: 333 SSSS 336



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 214 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 273

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 274 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 333

Query: 439 DQSS 450
SS
Sbjct: 334 SSSS 337



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 215 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 274

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 275 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 334

Query: 439 DQSS 450
SS
Sbjct: 335 SSSS 338



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 216 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 275

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 276 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 335

Query: 439 DQSS 450
SS
Sbjct: 336 SSSS 339



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 217 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 276

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 277 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 336

Query: 439 DQSS 450
SS
Sbjct: 337 SSSS 340



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 218 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 277

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 278 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 337

Query: 439 DQSS 450
SS
Sbjct: 338 SSSS 341



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 219 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 278

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 279 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 338

Query: 439 DQSS 450
SS
Sbjct: 339 SSSS 342



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 220 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 279

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 280 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 339

Query: 439 DQSS 450
SS
Sbjct: 340 SSSS 343



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 221 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 280

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 281 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 340

Query: 439 DQSS 450
SS
Sbjct: 341 SSSS 344



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 222 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 281

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 282 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 341

Query: 439 DQSS 450
SS
Sbjct: 342 SSSS 345



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 223 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 282

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 283 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 342

Query: 439 DQSS 450
SS
Sbjct: 343 SSSS 346



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 224 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 283

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 284 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 343

Query: 439 DQSS 450
SS
Sbjct: 344 SSSS 347



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 225 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 284

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 285 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 344

Query: 439 DQSS 450
SS
Sbjct: 345 SSSS 348



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 226 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 285

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 286 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 345

Query: 439 DQSS 450
SS
Sbjct: 346 SSSS 349



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 227 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 286

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 287 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 346

Query: 439 DQSS 450
SS
Sbjct: 347 SSSS 350



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 228 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 287

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 288 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 347

Query: 439 DQSS 450
SS
Sbjct: 348 SSSS 351



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 229 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 288

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 289 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 348

Query: 439 DQSS 450
SS
Sbjct: 349 SSSS 352



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 230 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 289

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 290 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 349

Query: 439 DQSS 450
SS
Sbjct: 350 SSSS 353



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 231 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 290

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 291 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 350

Query: 439 DQSS 450
SS
Sbjct: 351 SSSS 354



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 232 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 291

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 292 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 351

Query: 439 DQSS 450
SS
Sbjct: 352 SSSS 355



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 233 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 292

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 293 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 352

Query: 439 DQSS 450
SS
Sbjct: 353 SSSS 356



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 234 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 293

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 294 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 353

Query: 439 DQSS 450
SS
Sbjct: 354 SSSS 357



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 235 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 294

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 295 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 354

Query: 439 DQSS 450
SS
Sbjct: 355 SSSS 358



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 236 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 295

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 296 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 355

Query: 439 DQSS 450
SS
Sbjct: 356 SSSS 359



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 237 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 296

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 297 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 356

Query: 439 DQSS 450
SS
Sbjct: 357 SSSS 360



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 238 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 297

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 298 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 357

Query: 439 DQSS 450
SS
Sbjct: 358 SSSS 361



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 239 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 298

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 299 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 358

Query: 439 DQSS 450
SS
Sbjct: 359 SSSS 362



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 240 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 299

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 300 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 359

Query: 439 DQSS 450
SS
Sbjct: 360 SSSS 363



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 241 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 300

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 301 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 360

Query: 439 DQSS 450
SS
Sbjct: 361 SSSS 364



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 242 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 301

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 302 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 361

Query: 439 DQSS 450
SS
Sbjct: 362 SSSS 365



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 243 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 302

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 303 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 362

Query: 439 DQSS 450
SS
Sbjct: 363 SSSS 366



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 244 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 303

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 304 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 363

Query: 439 DQSS 450
SS
Sbjct: 364 SSSS 367



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 245 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 304

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 305 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 364

Query: 439 DQSS 450
SS
Sbjct: 365 SSSS 368



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 246 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 305

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 306 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 365

Query: 439 DQSS 450
SS
Sbjct: 366 SSSS 369



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 247 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 306

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 307 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 366

Query: 439 DQSS 450
SS
Sbjct: 367 SSSS 370



Score = 38.1 bits (87), Expect = 0.029
Identities = 32/124 (25%), Positives = 58/124 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 248 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 307

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLAD 438
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ +
Sbjct: 308 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 367

Query: 439 DQSS 450
SS
Sbjct: 368 SSSS 371



Score = 37.7 bits (86), Expect = 0.038
Identities = 31/117 (26%), Positives = 56/117 (47%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 256 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 315

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIG 429
S + S+ ++ S + +S S + SSSS + S++SSSS++ + ++ G
Sbjct: 316 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSG 372



Score = 37.4 bits (85), Expect = 0.050
Identities = 27/107 (25%), Positives = 54/107 (50%)
Frame = +1

Query: 130 GHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETSSPFIAMDDSAIANPVPS 309
G S ++I+ +S + SSSS+ S + + S + + +SS + S+ ++ S
Sbjct: 55 GVASFLNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

Query: 310 MAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLADDQSS 450
+ +S S + SSSS + S++SSSS++ + ++ + SS
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 161



Score = 37.4 bits (85), Expect = 0.050
Identities = 32/130 (24%), Positives = 59/130 (45%)
Frame = +1

Query: 61 SLRGALSSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSK 240
S L + S + +SS S S S +S + SSSS+ S + + S
Sbjct: 58 SFLNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 117

Query: 241 NWAETSSPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAA 420
+ + +SS + S+ ++ S + +S S + SSSS + S++SSSS++ + ++
Sbjct: 118 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 177

Query: 421 GIGLADDQSS 450
+ SS
Sbjct: 178 SSSSSSSSSS 187



Score = 36.6 bits (83), Expect = 0.085
Identities = 32/127 (25%), Positives = 58/127 (45%)
Frame = +1

Query: 70 GALSSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWA 249
G S S + +SS S S S +S + SSSS+ S + + S + +
Sbjct: 55 GVASFLNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

Query: 250 ETSSPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIG 429
+SS + S+ ++ S + +S S + SSSS + S++SSSS++ + ++
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

Query: 430 LADDQSS 450
+ SS
Sbjct: 175 SSSSSSS 181



Score = 36.2 bits (82), Expect = 0.11
Identities = 30/108 (27%), Positives = 50/108 (46%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S +S + SSSS+ S + + S + + +S
Sbjct: 267 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 326

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNN 402
S + S+ ++ S + +S S + SSSS + S++SSS N
Sbjct: 327 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGEN 374


>sp|O42970|YB95_SCHPO Uncharacterized serine-rich protein C1E8.05
OS=Schizosaccharomyces pombe GN=SPBC1E8.05 PE=2 SV=1
Length = 317

Score = 37.0 bits (84), Expect = 0.065
Identities = 40/135 (29%), Positives = 62/135 (45%), Gaps = 5/135 (3%)
Frame = +1

Query: 61 SLRGALSSFRKKQKSFDTWASSD----GHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKF 228
S G +SS T SS S S S +S + SSS+ S ++ +
Sbjct: 122 SYSGTISSTSIAPSMIGTRTSSSYFITSSSSTPSSSSSSSSSSPSSSSSKSSSSSKSSSS 181

Query: 229 LHSKNWAETSSPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGA 408
S + + +SS + S+ ++ S A S SK + + SSSSF +T +SSS++GA
Sbjct: 182 SSSSSKSSSSSSSSSKSSSSSSSSSKSSASPSSSK-SSSKFSSSSFITSTTPASSSSSGA 240

Query: 409 CLA-AGIGLADDQSS 450
++ A DD SS
Sbjct: 241 IVSNAKTASTDDSSS 255


>sp|Q93538|RB3GP_CAEEL Rab3 GTPase-activating protein catalytic
subunit OS=Caenorhabditis elegans GN=rbg-1 PE=2 SV=1
Length = 915

Score = 36.6 bits (83), Expect = 0.084
Identities = 16/41 (39%), Positives = 22/41 (53%)
Frame = -2

Query: 488 LSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTL 366
+S RM N+W W +A PIP A QA +F++ E L
Sbjct: 664 ISERMLISNNVWVRSWEAALPIPVANQARIFNDTKIAEEIL 704


>sp|Q17RH7|TPRXL_HUMAN Putative protein TPRXL OS=Homo sapiens
GN=TPRXL PE=2 SV=1
Length = 257

Score = 35.0 bits (79), Expect = 0.25
Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 2/136 (1%)
Frame = +1

Query: 49 LLLFSLRGALSSFRKKQKSFDTWASSDGHCSMV--SIISYTSDNCSSSSAVMSLRQAEVT 222
+L S+ + SS S + + S H S S S +S + SSSS+ S + +
Sbjct: 50 ILSSSIPSSSSSSSSPSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSPSSSNSS 109

Query: 223 KFLHSKNWAETSSPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNN 402
S + + +SS + S+ ++P S + +S S + SSS + S++SSS ++
Sbjct: 110 SSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSS 169

Query: 403 GACLAAGIGLADDQSS 450
+ ++G + SS
Sbjct: 170 SSPSSSGSSPSSSNSS 185



Score = 32.7 bits (73), Expect = 1.2
Identities = 31/129 (24%), Positives = 58/129 (44%)
Frame = +1

Query: 64 LRGALSSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKN 243
L ++ S S + + S H S S++S + SSSS+ T S +
Sbjct: 46 LSSSILSSSIPSSSSSSSSPSSSHSSSSPSSSHSSSSPSSSSS---------TSSPSSSS 96

Query: 244 WAETSSPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAG 423
+ +SSP + S+ ++ PS + +S S + SS S + S++SS S++ + ++
Sbjct: 97 SSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSS 156

Query: 424 IGLADDQSS 450
+ SS
Sbjct: 157 SSSSSSSSS 165



Score = 32.0 bits (71), Expect = 2.1
Identities = 34/125 (27%), Positives = 53/125 (42%), Gaps = 8/125 (6%)
Frame = +1

Query: 79 SSFRKKQKSFDTWASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETS 258
SS S + +SS S S S S + SS S+ S + + S + S
Sbjct: 118 SSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGS 177

Query: 259 SPFIAMDDSAIANPVPSMAMNSCSKRDAGEISSSSFN--------VLSTASSSSNNGACL 414
SP + + ++ PS + +S S R + SSSS S+ SSSS + +C
Sbjct: 178 SPSSSNSSPSSSSSSPSSSSSSPSPRSSSPSSSSSSTSSPSTSSPSSSSPSSSSPSSSCP 237

Query: 415 AAGIG 429
+A +G
Sbjct: 238 SAALG 242



Score = 31.6 bits (70), Expect = 2.7
Identities = 28/103 (27%), Positives = 50/103 (48%)
Frame = +1

Query: 157 SYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETSSPFIAMDDSAIANPVPSMAMNSCSKR 336
S++S + SSS + S + T S + + +SSP + S+ ++ PS + +S S
Sbjct: 68 SHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSS 127

Query: 337 DAGEISSSSFNVLSTASSSSNNGACLAAGIGLADDQSSCQRLP 465
+ SSSS S++SSSS+ + ++ + SS P
Sbjct: 128 PS---SSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSP 167



Score = 30.8 bits (68), Expect = 4.7
Identities = 28/111 (25%), Positives = 49/111 (44%)
Frame = +1

Query: 118 ASSDGHCSMVSIISYTSDNCSSSSAVMSLRQAEVTKFLHSKNWAETSSPFIAMDDSAIAN 297
+SS S + S + SSSS+ S + HS + +SS + S+ ++
Sbjct: 40 SSSRSILSSSILSSSIPSSSSSSSSPSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSS 99

Query: 298 PVPSMAMNSCSKRDAGEISSSSFNVLSTASSSSNNGACLAAGIGLADDQSS 450
+ NS S + SSSS + S+ SSSS++ + ++ + SS
Sbjct: 100 SSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSS 150


tr_hit_id A9T509
Definition tr|A9T509|A9T509_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 143
Score (bit) 154.0
E-value 2.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913983|Adiantum capillus-veneris mRNA, clone:
YMU001_000038_E10.
(555 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T509|A9T509_PHYPA Predicted protein OS=Physcomitrella paten... 154 2e-36
tr|A9SFI9|A9SFI9_PHYPA Predicted protein OS=Physcomitrella paten... 149 1e-34
tr|Q9FLQ5|Q9FLQ5_ARATH Arabidopsis thaliana genomic DNA, chromos... 133 6e-30
tr|Q683D2|Q683D2_ARATH Putative uncharacterized protein At5g5506... 133 6e-30
tr|A9SYK0|A9SYK0_PHYPA Predicted protein OS=Physcomitrella paten... 132 9e-30
tr|A7P0N2|A7P0N2_VITVI Chromosome chr19 scaffold_4, whole genome... 132 9e-30
tr|Q6Z4A0|Q6Z4A0_ORYSJ Os07g0511000 protein OS=Oryza sativa subs... 128 2e-28
tr|B8B6P7|B8B6P7_ORYSI Putative uncharacterized protein OS=Oryza... 128 2e-28
tr|A3BK81|A3BK81_ORYSJ Putative uncharacterized protein OS=Oryza... 100 9e-20
tr|B0WQ63|B0WQ63_CULQU Putative uncharacterized protein OS=Culex... 64 7e-09
tr|B0W9U8|B0W9U8_CULQU Putative uncharacterized protein OS=Culex... 62 2e-08
tr|A7RGH8|A7RGH8_NEMVE Predicted protein (Fragment) OS=Nematoste... 62 2e-08
tr|Q8RWW8|Q8RWW8_ARATH Putative uncharacterized protein At5g5851... 59 2e-07
tr|Q175P2|Q175P2_AEDAE Putative uncharacterized protein OS=Aedes... 59 2e-07
tr|Q16WP8|Q16WP8_AEDAE Putative uncharacterized protein OS=Aedes... 59 2e-07
tr|B6PX50|B6PX50_BRAFL Putative uncharacterized protein (Fragmen... 59 2e-07
tr|Q9FGH1|Q9FGH1_ARATH Genomic DNA, chromosome 5, P1 clone:MQJ2 ... 58 3e-07
tr|A9UVS6|A9UVS6_MONBE Predicted protein OS=Monosiga brevicollis... 58 4e-07
tr|Q3UYK8|Q3UYK8_MOUSE Putative uncharacterized protein OS=Mus m... 57 5e-07
tr|Q3TPB6|Q3TPB6_MOUSE Putative uncharacterized protein OS=Mus m... 57 5e-07
tr|Q5RF09|Q5RF09_PONAB Putative uncharacterized protein DKFZp469... 57 7e-07
tr|A4FUE5|A4FUE5_BOVIN RAB3GAP1 protein OS=Bos taurus GN=RAB3GAP... 57 7e-07
tr|B6M9P8|B6M9P8_BRAFL Putative uncharacterized protein (Fragmen... 57 7e-07
tr|A6H8Z3|A6H8Z3_HUMAN RAB3GAP1 protein OS=Homo sapiens GN=RAB3G... 57 7e-07
tr|A5APB2|A5APB2_VITVI Putative uncharacterized protein OS=Vitis... 56 1e-06
tr|Q54DM6|Q54DM6_DICDI Putative uncharacterized protein OS=Dicty... 56 1e-06
tr|B4KII0|B4KII0_DROMO GI17081 OS=Drosophila mojavensis GN=GI170... 55 2e-06
tr|A7NYA5|A7NYA5_VITVI Chromosome chr6 scaffold_3, whole genome ... 55 3e-06
tr|A4S622|A4S622_OSTLU Predicted protein OS=Ostreococcus lucimar... 54 7e-06
tr|B3RRY5|B3RRY5_TRIAD Putative uncharacterized protein OS=Trich... 53 1e-05

>tr|A9T509|A9T509_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_168098 PE=4 SV=1
Length = 1041

Score = 154 bits (390), Expect = 2e-36
Identities = 76/143 (53%), Positives = 102/143 (71%)
Frame = -2

Query: 539 LESSAKETKHGTECRGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNE 360
LE S + RGYLSARMQSQGNLWQELWSS+RP+PA +Q+PLFDEELA ESTL+
Sbjct: 806 LEGSEEIAGRVGAVRGYLSARMQSQGNLWQELWSSSRPVPAIKQSPLFDEELAGESTLDV 865

Query: 359 LEDISPASLFEQLFIAILGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRKDMTAEEL 180
LED++P+ LFEQLF++ L GFAIAE++ K E+++ EC +V + C + M+ +L
Sbjct: 866 LEDVAPSDLFEQLFLSALSAGFAIAEAAPVAKTEVLARCLRECSEYVVATCGRGMSTSKL 925

Query: 179 EQLSEVYEMMETMLQCPSEDAQV 111
++L EVYE+ME+ + P D V
Sbjct: 926 DRLCEVYEVMESAIHSPPCDEPV 948


>tr|A9SFI9|A9SFI9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_164628 PE=4 SV=1
Length = 771

Score = 149 bits (376), Expect = 1e-34
Identities = 72/142 (50%), Positives = 98/142 (69%)
Frame = -2

Query: 536 ESSAKETKHGTECRGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNEL 357
+ S++ RGYLSARMQ QGNLWQELW+S+RP+PA +Q+PLFDEELA ESTL+ L
Sbjct: 535 QGSSENAGENGAVRGYLSARMQCQGNLWQELWASSRPVPALKQSPLFDEELAGESTLDVL 594

Query: 356 EDISPASLFEQLFIAILGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRKDMTAEELE 177
E ++P+ LFEQLF+ LGTGFAIAE++ K E ++ EC V + C + M++ +LE
Sbjct: 595 EAVAPSDLFEQLFLTALGTGFAIAEAASVTKTEALTRCLKECTEHVVATCGRGMSSSKLE 654

Query: 176 QLSEVYEMMETMLQCPSEDAQV 111
+L +YE ME+ + P D V
Sbjct: 655 RLCGIYEAMESAVHSPPSDDDV 676


>tr|Q9FLQ5|Q9FLQ5_ARATH Arabidopsis thaliana genomic DNA, chromosome
5, P1 clone:MCO15 OS=Arabidopsis thaliana GN=At5g55060
PE=4 SV=1
Length = 645

Score = 133 bits (335), Expect = 6e-30
Identities = 65/125 (52%), Positives = 87/125 (69%)
Frame = -2

Query: 497 RGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNELEDISPASLFEQLF 318
RG LS RMQ +GNLW+ELW +A+P+PA +QAPLFDE+LAVE LN LEDI A LFEQLF
Sbjct: 441 RGQLSTRMQKEGNLWRELWETAKPLPAVKQAPLFDEDLAVEGILNYLEDIPAAELFEQLF 500

Query: 317 IAILGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRKDMTAEELEQLSEVYEMMETML 138
+++ GF + E +A +L S F ECK++V + C+ ++L+ L +VYE +ETML
Sbjct: 501 TSLVSLGFVMVEPVLATNDDL-SKLFFECKDYVVAICQGGAWTDKLDDLCQVYETVETML 559

Query: 137 QCPSE 123
P E
Sbjct: 560 LRPEE 564


>tr|Q683D2|Q683D2_ARATH Putative uncharacterized protein At5g55060
OS=Arabidopsis thaliana GN=At5g55060 PE=2 SV=1
Length = 662

Score = 133 bits (335), Expect = 6e-30
Identities = 65/125 (52%), Positives = 87/125 (69%)
Frame = -2

Query: 497 RGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNELEDISPASLFEQLF 318
RG LS RMQ +GNLW+ELW +A+P+PA +QAPLFDE+LAVE LN LEDI A LFEQLF
Sbjct: 458 RGQLSTRMQKEGNLWRELWETAKPLPAVKQAPLFDEDLAVEGILNYLEDIPAAELFEQLF 517

Query: 317 IAILGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRKDMTAEELEQLSEVYEMMETML 138
+++ GF + E +A +L S F ECK++V + C+ ++L+ L +VYE +ETML
Sbjct: 518 TSLVSLGFVMVEPVLATNDDL-SKLFFECKDYVVAICQGGAWTDKLDDLCQVYETVETML 576

Query: 137 QCPSE 123
P E
Sbjct: 577 LRPEE 581


>tr|A9SYK0|A9SYK0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_234512 PE=4 SV=1
Length = 1020

Score = 132 bits (333), Expect = 9e-30
Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 18/155 (11%)
Frame = -2

Query: 536 ESSAKETKHGTECRGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNEL 357
+ SA+ RGYLSARMQ QGNLWQELW+S+RP+PA +Q+PLFDEELA ESTL+ L
Sbjct: 769 QGSAENAGEYGAIRGYLSARMQCQGNLWQELWASSRPVPALKQSPLFDEELAGESTLDVL 828

Query: 356 EDISPASLFEQLFIAILGTGF---------------AIAESSMAMKGELVSAQFLECKNF 222
ED++P+ LFEQLF+A + F AI E++ A K E ++ EC +
Sbjct: 829 EDVAPSDLFEQLFLAAVCAYFVTLILISFKPVYDCVAIVEAAPAAKTETLARCLKECTEY 888

Query: 221 VTSACRKDMTAEELEQLSEVYEMMETML---QCPS 126
+ C ++M++ +LE+L EVYE ME L QC S
Sbjct: 889 LVITCEREMSSSKLERLCEVYEDMEFALHLAQCGS 923


>tr|A7P0N2|A7P0N2_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027298001
PE=4 SV=1
Length = 687

Score = 132 bits (333), Expect = 9e-30
Identities = 62/131 (47%), Positives = 94/131 (71%)
Frame = -2

Query: 497 RGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNELEDISPASLFEQLF 318
RG LS+RM+ +GNLW ELW +A+P+PA +QAPLFDE+LAVE L+ L+DI P+ LF+QLF
Sbjct: 471 RGQLSSRMRKEGNLWCELWKTAKPLPAVKQAPLFDEDLAVEGILHFLDDIPPSELFKQLF 530

Query: 317 IAILGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRKDMTAEELEQLSEVYEMMETML 138
+++LG GF IAE++++ L S F ECK++ + C++ ++++ L +VYE +E ML
Sbjct: 531 VSLLGLGFVIAEATLSTNSNL-SKLFHECKDYTIATCQRGTWIDKIDDLCQVYETVEMML 589

Query: 137 QCPSEDAQVSK 105
P E ++ K
Sbjct: 590 LHPEEILKIMK 600


>tr|Q6Z4A0|Q6Z4A0_ORYSJ Os07g0511000 protein OS=Oryza sativa subsp.
japonica GN=P0409B11.37 PE=2 SV=1
Length = 666

Score = 128 bits (322), Expect = 2e-28
Identities = 75/177 (42%), Positives = 108/177 (61%), Gaps = 2/177 (1%)
Frame = -2

Query: 542 CLESSAKETKHGTECRGYLSARMQS-QGNLWQELWSSARPIPAARQAPLFDEELAVESTL 366
C SSA E G+ RG LS RMQ+ +GNLW+ELW +A+PIPA QAP++DE+LAVES
Sbjct: 423 CAASSA-EVGEGSSRRGRLSERMQTKEGNLWKELWGAAKPIPAVEQAPIYDEDLAVESIF 481

Query: 365 NELEDISPASLFEQLFIAILGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRKDMTAE 186
+ LE I P+ LFEQL IL F AE + G +S F +CK+++ S + D++ E
Sbjct: 482 DALEVIEPSKLFEQLLAVILSVCFVAAELVLP-AGSNLSKLFYDCKDYILSIYQDDISKE 540

Query: 185 ELEQLSEVYEMMETMLQCPSEDAQVSKLFCFFRNDESAPL-SEKRSKYCHNLVANER 18
+L+++ +VYE ME ++ P E Q+ + DE +PL S+ R K N + +R
Sbjct: 541 KLDEICKVYETMEAIVTHPEETLQIME-----APDEKSPLESKNRFKIKLNFIGKDR 592


>tr|B8B6P7|B8B6P7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26159 PE=4 SV=1
Length = 666

Score = 128 bits (322), Expect = 2e-28
Identities = 75/177 (42%), Positives = 108/177 (61%), Gaps = 2/177 (1%)
Frame = -2

Query: 542 CLESSAKETKHGTECRGYLSARMQS-QGNLWQELWSSARPIPAARQAPLFDEELAVESTL 366
C SSA E G+ RG LS RMQ+ +GNLW+ELW +A+PIPA QAP++DE+LAVES
Sbjct: 423 CAASSA-EVGEGSSRRGRLSERMQTKEGNLWKELWGAAKPIPAVEQAPIYDEDLAVESIF 481

Query: 365 NELEDISPASLFEQLFIAILGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRKDMTAE 186
+ LE I P+ LFEQL IL F AE + G +S F +CK+++ S + D++ E
Sbjct: 482 DALEVIEPSKLFEQLLAVILSVCFVAAELVLP-AGSNLSKLFYDCKDYILSIYQDDISKE 540

Query: 185 ELEQLSEVYEMMETMLQCPSEDAQVSKLFCFFRNDESAPL-SEKRSKYCHNLVANER 18
+L+++ +VYE ME ++ P E Q+ + DE +PL S+ R K N + +R
Sbjct: 541 KLDEICKVYETMEAIVTHPEETLQIME-----APDEKSPLESKNRFKIKLNFIGKDR 592


>tr|A3BK81|A3BK81_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_023453 PE=4 SV=1
Length = 652

Score = 99.8 bits (247), Expect = 9e-20
Identities = 60/181 (33%), Positives = 92/181 (50%), Gaps = 31/181 (17%)
Frame = -2

Query: 467 QGNLWQELWSSARPIPAARQAPLFDEELAVESTLNELEDISPASLFEQLFIAILGTGFAI 288
+GNLW+ELW +A+PIPA QAP++DE+LAVES + LE I P+ LFEQL I + I
Sbjct: 403 EGNLWKELWGAAKPIPAVEQAPIYDEDLAVESIFDALEVIEPSKLFEQLLAVIKAISWLI 462

Query: 287 ------------------------------AESSMAMKGELVSAQFLECKNFVTSACRKD 198
A + G +S F +CK+++ S + D
Sbjct: 463 TLQVTSYLYQDKCNALPHAICGYQLSVCFVAAELVLPAGSNLSKLFYDCKDYILSIYQDD 522

Query: 197 MTAEELEQLSEVYEMMETMLQCPSEDAQVSKLFCFFRNDESAPL-SEKRSKYCHNLVANE 21
++ E+L+++ +VYE ME ++ P E Q+ + DE +PL S+ R K N + +
Sbjct: 523 ISKEKLDEICKVYETMEAIVTHPEETLQIME-----APDEKSPLESKNRFKIKLNFIGKD 577

Query: 20 R 18
R
Sbjct: 578 R 578


>tr|B0WQ63|B0WQ63_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ009195 PE=4 SV=1
Length = 412

Score = 63.5 bits (153), Expect = 7e-09
Identities = 35/99 (35%), Positives = 51/99 (51%)
Frame = -2

Query: 497 RGYLSARMQSQGNLWQELWSSARPIPAARQAPLFDEELAVESTLNELEDISPASLFEQLF 318
+G+LS+RM GN WQ +W +AR +PA RQ LFD+ E L+ LE S + +
Sbjct: 166 KGHLSSRMLIPGNTWQTVWENARAVPARRQKRLFDDAKEAEKVLHFLESRSIGQIAQLTT 225

Query: 317 IAILGTGFAIAESSMAMKGELVSAQFLECKNFVTSACRK 201
A+ T + A+ G+ + A F E +TS C K
Sbjct: 226 AALFHTAIKTLSTEAAIDGKAIPA-FTESMEKITSTCCK 263