BP913990
Clone id YMU001_000038_F05
Library
Length 539
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000038_F05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGGGATCGTGTCGGCCATACATGATGCACAATTATTTCAGAAAGTAAATGATAACTAAGC
CTCACATAGCTCATACACCATGTTACAATCTCCCATTTGAAGGAAAAAGGGAAACATTAA
TGGAGCAATCTCATTTTATATGGCCCTTCCAACAAGGCGAATGCACCTTGTTATTACAGT
TCTTGTACAAACACTTGGGCATGACCCCTGCCTACAAAAATGATCACACTTCGTGGCAAA
AGAATTGCTCATATATACAGAGCTCATCCTACAGAAGAAATCATGAGACAGACATGAATC
ATCATAGCTCAATGGTTTGCTGATTGAGAGCTTGATAATGCCAGAGTTCCTGATTAACAA
ATTGTGGCTCAAGAAATCTACAAACAAACCACCAAAGCCTATACACATCTGAAAAGTTGT
TTAGAAACCCCAGTGATACATATAGTACAGGCATCTCGAGTCTTTGCACCGTGTCATCTT
TGGAGAGGCACTTGTAGACCCCCGACATCTCCATGCACCCGACTAAACGCTCTTCATGG
■■Homology search results ■■ -
sp_hit_id Q559G8
Definition sp|Q559G8|MOCOS_DICDI Molybdenum cofactor sulfurase OS=Dictyostelium discoideum
Align length 55
Score (bit) 30.4
E-value 5.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913990|Adiantum capillus-veneris mRNA, clone:
YMU001_000038_F05.
(539 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q559G8|MOCOS_DICDI Molybdenum cofactor sulfurase OS=Dictyoste... 30 5.7
sp|O00339|MATN2_HUMAN Matrilin-2 OS=Homo sapiens GN=MATN2 PE=1 SV=3 30 9.8
sp|O13939|AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharo... 30 9.8
sp|Q99965|ADAM2_HUMAN Disintegrin and metalloproteinase domain-c... 30 9.8

>sp|Q559G8|MOCOS_DICDI Molybdenum cofactor sulfurase
OS=Dictyostelium discoideum GN=mocos PE=3 SV=1
Length = 1012

Score = 30.4 bits (67), Expect = 5.7
Identities = 14/55 (25%), Positives = 26/55 (47%)
Frame = -2

Query: 490 CLSKDDTVQRLEMPVLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQAL 326
C D + + +S G++NNF+DVY+ FL+ F+N + + +
Sbjct: 555 CWDSKDILNGKPTGSVRISFGYMNNFNDVYKF----INFLKSNFINDHKFEKEVI 605


>sp|O00339|MATN2_HUMAN Matrilin-2 OS=Homo sapiens GN=MATN2 PE=1 SV=3
Length = 956

Score = 29.6 bits (65), Expect = 9.8
Identities = 21/62 (33%), Positives = 24/62 (38%)
Frame = -3

Query: 411 QMCIGFGGLFVDFLSHNLLIRNSGIIKLSISKPLSYDDSCLSHDFFCRMSSVYMSNSFAT 232
Q+C+ FV S LI K S D CL D C S V M SFA
Sbjct: 456 QLCLNTEDSFVCQCSEGFLINED-------LKTCSRVDYCLLSDHGCEYSCVNMDRSFAC 508

Query: 231 KC 226
+C
Sbjct: 509 QC 510


>sp|O13939|AP3B_SCHPO AP-3 complex subunit beta
OS=Schizosaccharomyces pombe GN=apl6 PE=1 SV=1
Length = 745

Score = 29.6 bits (65), Expect = 9.8
Identities = 13/34 (38%), Positives = 21/34 (61%)
Frame = +2

Query: 116 INGAISFYMALPTRRMHLVITVLVQTLGHDPCLQ 217
I GA +FY P+ +MHL++ L+Q L P ++
Sbjct: 279 IAGARAFYYLAPSNQMHLIVEPLLQLLLEKPIVR 312


>sp|Q99965|ADAM2_HUMAN Disintegrin and metalloproteinase
domain-containing protein 2 OS=Homo sapiens GN=ADAM2
PE=2 SV=2
Length = 735

Score = 29.6 bits (65), Expect = 9.8
Identities = 11/26 (42%), Positives = 15/26 (57%)
Frame = -2

Query: 178 CNNKVHSPCWKGHIK*DCSINVSLFP 101
CNNK H C ++ DCS+ L+P
Sbjct: 627 CNNKKHCHCSASYLPPDCSVQSDLWP 652


tr_hit_id B8B9C3
Definition tr|B8B9C3|B8B9C3_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 59
Score (bit) 67.4
E-value 5.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP913990|Adiantum capillus-veneris mRNA, clone:
YMU001_000038_F05.
(539 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8B9C3|B8B9C3_ORYSI Putative uncharacterized protein OS=Oryza... 67 5e-10
tr|A7R1T5|A7R1T5_VITVI Chromosome undetermined scaffold_376, who... 67 8e-10
tr|Q6ZBH4|Q6ZBH4_ORYSJ Os08g0545000 protein OS=Oryza sativa subs... 66 1e-09
tr|A2YXQ3|A2YXQ3_ORYSI Putative uncharacterized protein OS=Oryza... 66 1e-09
tr|B8A1Q9|B8A1Q9_MAIZE Putative uncharacterized protein OS=Zea m... 65 2e-09
tr|B4FNI7|B4FNI7_MAIZE Putative uncharacterized protein OS=Zea m... 65 2e-09
tr|A9REN7|A9REN7_PHYPA Predicted protein OS=Physcomitrella paten... 62 1e-08
tr|A7QKE0|A7QKE0_VITVI Chromosome chr2 scaffold_112, whole genom... 62 2e-08
tr|A9RG94|A9RG94_PHYPA Predicted protein OS=Physcomitrella paten... 59 1e-07
tr|A9TR75|A9TR75_PHYPA Predicted protein OS=Physcomitrella paten... 59 2e-07
tr|A9U2B6|A9U2B6_PHYPA Predicted protein OS=Physcomitrella paten... 52 2e-05
tr|Q2QMU3|Q2QMU3_ORYSJ Os12g0590900 protein OS=Oryza sativa subs... 51 4e-05
tr|A3CJ02|A3CJ02_ORYSJ Putative uncharacterized protein OS=Oryza... 51 4e-05
tr|A2ZM89|A2ZM89_ORYSI Putative uncharacterized protein OS=Oryza... 51 4e-05
tr|O82746|O82746_ARATH Putative uncharacterized protein F7H19.16... 50 1e-04
tr|Q9FGL6|Q9FGL6_ARATH Genomic DNA, chromosome 5, P1 clone:MJM18... 49 2e-04
tr|Q9FGD5|Q9FGD5_ARATH Emb|CAB16785.1 OS=Arabidopsis thaliana GN... 48 4e-04
tr|Q7Y0C6|Q7Y0C6_ORYSJ Os03g0765800 protein OS=Oryza sativa subs... 48 4e-04
tr|Q10EM3|Q10EM3_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 48 4e-04
tr|A3AN05|A3AN05_ORYSJ Putative uncharacterized protein OS=Oryza... 48 4e-04
tr|A2XMB0|A2XMB0_ORYSI Putative uncharacterized protein OS=Oryza... 48 4e-04
tr|A7R4L8|A7R4L8_VITVI Chromosome undetermined scaffold_741, who... 47 5e-04
tr|A7R4E4|A7R4E4_VITVI Chromosome undetermined scaffold_670, who... 47 5e-04
tr|A5AMA2|A5AMA2_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|O80468|O80468_ARATH Putative uncharacterized protein At2g2352... 42 0.016
tr|O23176|O23176_ARATH Putative uncharacterized protein C7A10.26... 42 0.016
tr|A7NTN6|A7NTN6_VITVI Chromosome chr18 scaffold_1, whole genome... 40 0.060
tr|A5BXA6|A5BXA6_VITVI Putative uncharacterized protein OS=Vitis... 40 0.060
tr|A9TRK0|A9TRK0_PHYPA Predicted protein OS=Physcomitrella paten... 36 1.1
tr|A9SLL0|A9SLL0_PHYPA Predicted protein OS=Physcomitrella paten... 36 1.1

>tr|B8B9C3|B8B9C3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_30127 PE=4 SV=1
Length = 897

Score = 67.4 bits (163), Expect = 5e-10
Identities = 30/59 (50%), Positives = 39/59 (66%)
Frame = -2

Query: 481 KDDTVQRLEMPVLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQTIEL 305
+ D + + V+ SLGFL NF D YRLW FV +FL+ FV +E W Y ALNQ+T+EL
Sbjct: 601 RKDAAGEMGIYVVNASLGFLTNFDDAYRLWAFVAKFLDADFVEKERWRYTALNQKTVEL 659


>tr|A7R1T5|A7R1T5_VITVI Chromosome undetermined scaffold_376, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00012400001 PE=4 SV=1
Length = 474

Score = 66.6 bits (161), Expect = 8e-10
Identities = 32/59 (54%), Positives = 41/59 (69%)
Frame = -2

Query: 481 KDDTVQRLEMPVLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQTIEL 305
KDD L + V+ +LGFL NF D+YRLW FV +FL+ FV +E W Y ALNQ+TIE+
Sbjct: 420 KDD----LGITVVTAALGFLTNFEDIYRLWAFVAQFLDADFVEKERWRYTALNQKTIEV 474


>tr|Q6ZBH4|Q6ZBH4_ORYSJ Os08g0545000 protein OS=Oryza sativa subsp.
japonica GN=P0623F08.34 PE=2 SV=1
Length = 659

Score = 66.2 bits (160), Expect = 1e-09
Identities = 29/59 (49%), Positives = 39/59 (66%)
Frame = -2

Query: 481 KDDTVQRLEMPVLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQTIEL 305
+ D + + V+ SLGFL NF D YRLW FV +FL+ FV +E W Y ALNQ+T+E+
Sbjct: 601 RKDAAGEMGIYVVNASLGFLTNFDDAYRLWAFVAKFLDADFVEKERWRYTALNQKTVEV 659


>tr|A2YXQ3|A2YXQ3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_30126 PE=4 SV=1
Length = 660

Score = 66.2 bits (160), Expect = 1e-09
Identities = 29/59 (49%), Positives = 39/59 (66%)
Frame = -2

Query: 481 KDDTVQRLEMPVLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQTIEL 305
+ D + + V+ SLGFL NF D YRLW FV +FL+ FV +E W Y ALNQ+T+E+
Sbjct: 602 RKDAAGEMGIYVVNASLGFLTNFDDAYRLWAFVAKFLDADFVEKERWRYTALNQKTVEV 660


>tr|B8A1Q9|B8A1Q9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 692

Score = 65.5 bits (158), Expect = 2e-09
Identities = 28/48 (58%), Positives = 36/48 (75%)
Frame = -2

Query: 448 VLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQTIEL 305
V+ SLGFL+NF D YRLW FV +FL+ FV +E W Y ALNQ+T+E+
Sbjct: 645 VVNASLGFLSNFEDAYRLWAFVAKFLDADFVEKERWRYTALNQKTVEV 692


>tr|B4FNI7|B4FNI7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 278

Score = 65.5 bits (158), Expect = 2e-09
Identities = 28/48 (58%), Positives = 36/48 (75%)
Frame = -2

Query: 448 VLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQTIEL 305
V+ SLGFL+NF D YRLW FV +FL+ FV +E W Y ALNQ+T+E+
Sbjct: 231 VVNASLGFLSNFEDAYRLWAFVAKFLDADFVEKERWRYTALNQKTVEV 278


>tr|A9REN7|A9REN7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_174193 PE=4 SV=1
Length = 511

Score = 62.4 bits (150), Expect = 1e-08
Identities = 31/55 (56%), Positives = 41/55 (74%)
Frame = -2

Query: 475 DTVQRLEMPVLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQTI 311
DT+ + V+ SL FL++F+DVYRL FV FL+ FV++EL+HYQALNQQTI
Sbjct: 455 DTLHAGQFSVVCASLCFLSSFTDVYRLLEFVALFLDADFVHKELFHYQALNQQTI 509


>tr|A7QKE0|A7QKE0_VITVI Chromosome chr2 scaffold_112, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001078001
PE=4 SV=1
Length = 652

Score = 61.6 bits (148), Expect = 2e-08
Identities = 27/48 (56%), Positives = 34/48 (70%)
Frame = -2

Query: 448 VLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQTIEL 305
V+ +LG L NF DVY LW FV RFL+ FV +E W Y ALNQ+T+E+
Sbjct: 605 VVSAALGLLTNFEDVYNLWAFVSRFLDADFVEKERWRYVALNQKTVEV 652


>tr|A9RG94|A9RG94_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_113639 PE=4 SV=1
Length = 574

Score = 59.3 bits (142), Expect = 1e-07
Identities = 24/47 (51%), Positives = 35/47 (74%)
Frame = -2

Query: 457 EMPVLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQ 317
E+PV+ +LGF++ F DVYRLW FV +FL+ FV +E W Y ++NQ+
Sbjct: 524 EIPVVTAALGFVSTFEDVYRLWAFVAKFLDADFVKREEWLYHSINQE 570


>tr|A9TR75|A9TR75_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_149364 PE=4 SV=1
Length = 637

Score = 58.9 bits (141), Expect = 2e-07
Identities = 25/48 (52%), Positives = 35/48 (72%)
Frame = -2

Query: 460 LEMPVLYVSLGFLNNFSDVYRLWWFVCRFLEPQFVNQELWHYQALNQQ 317
LE+PV+ +LGF++ F DVYRLW FV +FL+ FV +E W +LNQ+
Sbjct: 586 LEIPVVTAALGFVSTFEDVYRLWAFVAKFLDAGFVKREEWQQHSLNQE 633