BP914042
Clone id YMU001_000039_C02
Library
Length 505
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000039_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AATTCGTGGCCGCGAATTCTTCCAGTTTTTCAAAAAGTACCACCCTTCATGTTGATAGAA
AATTACATGGACACCACAGGGGCAATGAAGTATTACACATGCGCTTCGAGACATGATTGG
TGGAGCAAATGTGATTACACGATCATGTGAGCCCAGAGGCCACACAACCCAAAAATTTGA
GCAAATTTTATCATGCATCTCTAATGCAGCACAAAAGGAGCATCTTTAAGCCACCCACTT
CATCGGAGACCCTAACAGCATGTGAGGTTACCTGATTCACTTTCTCGACTGTCAAATGCT
TGCTGTCTGGAAAAACCATGTCCAAAGAAAGGTTTCAAAACTGTAGCACATGGTTGCAGA
GAGATTCCAGACGCAAGTTCAAGAACAAAGCTTCATGCCATCCTTTCTAGTAAAAAATTT
GCACAGTCAATAACTTGGCTTGCTGACTGAGCTTTACCTTGCCATACCATGTTGGTCCTT
GCTCATAATTCCAGTAGTTAAAGAA
■■Homology search results ■■ -
sp_hit_id Q9CXA2
Definition sp|Q9CXA2|PRCM_MOUSE Probable proline racemase OS=Mus musculus
Align length 28
Score (bit) 32.7
E-value 0.87
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914042|Adiantum capillus-veneris mRNA, clone:
YMU001_000039_C02.
(478 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9CXA2|PRCM_MOUSE Probable proline racemase OS=Mus musculus P... 33 0.87
sp|Q3SX04|PRCM_BOVIN Probable proline racemase OS=Bos taurus PE=... 32 1.1
sp|A1EC95|HEAT6_RAT HEAT repeat-containing protein 6 OS=Rattus n... 31 2.5
sp|Q5R5R2|HEAT6_PONAB HEAT repeat-containing protein 6 OS=Pongo ... 31 2.5
sp|Q6AI08|HEAT6_HUMAN HEAT repeat-containing protein 6 OS=Homo s... 31 2.5
sp|P34015|CRMB_VARV Soluble TNF receptor II OS=Variola virus GN=... 30 4.3
sp|Q96EM0|PRCM_HUMAN Probable proline racemase OS=Homo sapiens G... 30 5.6
sp|P68637|CRMB_CAMPS Soluble TNF receptor II OS=Camelpox virus (... 30 5.6
sp|P68636|CRMB_CAMPM Soluble TNF receptor II OS=Camelpox virus (... 30 5.6
sp|O73559|CRMB_CWPXG Soluble TNF receptor II OS=Cowpox virus (st... 30 7.4
sp|Q5HC04|RPOC_EHRRW DNA-directed RNA polymerase subunit beta' O... 25 7.7
sp|Q5FFD8|RPOC_EHRRG DNA-directed RNA polymerase subunit beta' O... 25 7.7

>sp|Q9CXA2|PRCM_MOUSE Probable proline racemase OS=Mus musculus PE=2
SV=1
Length = 354

Score = 32.7 bits (73), Expect = 0.87
Identities = 14/28 (50%), Positives = 18/28 (64%)
Frame = -2

Query: 99 APPIMSRSACVILHCPCGVHVIFYQHEG 16
APP +R A V +HCPCG+ F + EG
Sbjct: 123 APPKGAREAQVNIHCPCGLVTAFVECEG 150


>sp|Q3SX04|PRCM_BOVIN Probable proline racemase OS=Bos taurus PE=2
SV=1
Length = 354

Score = 32.3 bits (72), Expect = 1.1
Identities = 13/28 (46%), Positives = 18/28 (64%)
Frame = -2

Query: 99 APPIMSRSACVILHCPCGVHVIFYQHEG 16
APP ++ A V +HCPCG+ F + EG
Sbjct: 123 APPSDAQEALVNIHCPCGLVAAFVECEG 150


>sp|A1EC95|HEAT6_RAT HEAT repeat-containing protein 6 OS=Rattus
norvegicus GN=Heatr6 PE=2 SV=1
Length = 1252

Score = 31.2 bits (69), Expect = 2.5
Identities = 14/34 (41%), Positives = 22/34 (64%)
Frame = +2

Query: 263 CQMLAVWKNHVQRKVSKL*HMVAERFQTQVQEQS 364
CQ++ + +NH+ KVS+L H + R Q V EQ+
Sbjct: 154 CQLVPLNQNHLVSKVSQLIHRLLNRLQVIVDEQN 187


>sp|Q5R5R2|HEAT6_PONAB HEAT repeat-containing protein 6 OS=Pongo
abelii GN=HEATR6 PE=2 SV=1
Length = 1181

Score = 31.2 bits (69), Expect = 2.5
Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
Frame = +2

Query: 263 CQMLAVWKNHVQRKVSKL*HMVAERFQTQVQEQ--SFMPSFLVKNLH 397
C+++ + +NH+ KVS+L H + R Q V EQ F+ ++ + +H
Sbjct: 83 CRLVPLNQNHLVSKVSQLIHHLLNRLQVIVDEQRLDFLLAYTISAIH 129


>sp|Q6AI08|HEAT6_HUMAN HEAT repeat-containing protein 6 OS=Homo
sapiens GN=HEATR6 PE=1 SV=1
Length = 1181

Score = 31.2 bits (69), Expect = 2.5
Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
Frame = +2

Query: 263 CQMLAVWKNHVQRKVSKL*HMVAERFQTQVQEQ--SFMPSFLVKNLH 397
C+++ + +NH+ KVS+L H + R Q V EQ F+ ++ + +H
Sbjct: 83 CRLVPLNQNHLVSKVSQLIHHLLNRLQVIVDEQHLDFLLAYTISAIH 129


>sp|P34015|CRMB_VARV Soluble TNF receptor II OS=Variola virus
GN=CRMB PE=3 SV=1
Length = 349

Score = 30.4 bits (67), Expect = 4.3
Identities = 12/27 (44%), Positives = 16/27 (59%)
Frame = -1

Query: 115 SCNHICSTNHVSKRMCNTSLPLWCPCN 35
SCN C++N V R CNT+ C C+
Sbjct: 85 SCNGRCNSNQVETRSCNTTHNRICECS 111


>sp|Q96EM0|PRCM_HUMAN Probable proline racemase OS=Homo sapiens
GN=C14orf149 PE=1 SV=1
Length = 354

Score = 30.0 bits (66), Expect = 5.6
Identities = 12/23 (52%), Positives = 15/23 (65%)
Frame = -2

Query: 99 APPIMSRSACVILHCPCGVHVIF 31
APP +R A V +HCPCG+ F
Sbjct: 123 APPAGTREARVNIHCPCGLVTAF 145


>sp|P68637|CRMB_CAMPS Soluble TNF receptor II OS=Camelpox virus
(strain CMS) GN=CRMB1 PE=3 SV=1
Length = 349

Score = 30.0 bits (66), Expect = 5.6
Identities = 12/27 (44%), Positives = 15/27 (55%)
Frame = -1

Query: 115 SCNHICSTNHVSKRMCNTSLPLWCPCN 35
SCN C +N V R CNT+ C C+
Sbjct: 85 SCNGRCDSNQVETRSCNTTHNRICECS 111


>sp|P68636|CRMB_CAMPM Soluble TNF receptor II OS=Camelpox virus
(strain M-96) GN=CRMB1 PE=3 SV=1
Length = 349

Score = 30.0 bits (66), Expect = 5.6
Identities = 12/27 (44%), Positives = 15/27 (55%)
Frame = -1

Query: 115 SCNHICSTNHVSKRMCNTSLPLWCPCN 35
SCN C +N V R CNT+ C C+
Sbjct: 85 SCNGRCDSNQVETRSCNTTHNRICECS 111


>sp|O73559|CRMB_CWPXG Soluble TNF receptor II OS=Cowpox virus
(strain GRI-90 / Grishak) GN=CRMB1 PE=4 SV=1
Length = 351

Score = 29.6 bits (65), Expect = 7.4
Identities = 12/26 (46%), Positives = 14/26 (53%)
Frame = -1

Query: 115 SCNHICSTNHVSKRMCNTSLPLWCPC 38
SCN C +N V R CNT+ C C
Sbjct: 87 SCNGRCDSNQVETRSCNTTHNRICEC 112


tr_hit_id A7H8J6
Definition tr|A7H8J6|A7H8J6_ANADF Putative uncharacterized protein OS=Anaeromyxobacter sp. (strain Fw109-5)
Align length 44
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914042|Adiantum capillus-veneris mRNA, clone:
YMU001_000039_C02.
(478 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7H8J6|A7H8J6_ANADF Putative uncharacterized protein OS=Anaer... 34 3.2
tr|A5K2N2|A5K2N2_PLAVI Putative uncharacterized protein OS=Plasm... 34 4.2
tr|A8RUX8|A8RUX8_9CLOT Putative uncharacterized protein OS=Clost... 33 7.0
tr|A8BKC0|A8BKC0_GIALA Putative uncharacterized protein OS=Giard... 33 7.0
tr|B8JJ82|B8JJ82_MOUSE Novel protein (2810055F11Rik) OS=Mus musc... 33 9.2
tr|B6K9W5|B6K9W5_TOXGO Helicase, putative OS=Toxoplasma gondii M... 33 9.2

>tr|A7H8J6|A7H8J6_ANADF Putative uncharacterized protein
OS=Anaeromyxobacter sp. (strain Fw109-5) GN=Anae109_0831
PE=4 SV=1
Length = 249

Score = 34.3 bits (77), Expect = 3.2
Identities = 15/44 (34%), Positives = 23/44 (52%)
Frame = -2

Query: 141 VVWPLGSHDRVITFAPPIMSRSACVILHCPCGVHVIFYQHEGWY 10
V+W L H + P ++R + H P G H + ++HEGWY
Sbjct: 107 VLWQLPPHMK------PDLARLDRFLAHLPAGRHAVEFRHEGWY 144


>tr|A5K2N2|A5K2N2_PLAVI Putative uncharacterized protein OS=Plasmodium
vivax GN=PVX_115090 PE=4 SV=1
Length = 1411

Score = 33.9 bits (76), Expect = 4.2
Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 5/84 (5%)
Frame = +3

Query: 114 DHVS-PEATQPKNLSKFYHASLM---QHKRSIFKPPTSSETLTACEVT-*FTFSTVKCLL 278
DH S P + KNL +L+ ++KR +F P T + A EVT F F +C +
Sbjct: 911 DHTSSPPGEKDKNLKNGGKQNLLSGPENKRKVFSPKTDQRSSNADEVTHPFNFKEFECWM 970

Query: 279 SGKTMSKERFQNCSTWLQRDSRRK 350
SG+ + T++ +++R+K
Sbjct: 971 SGRYN-----KLLETYIDQENRKK 989


>tr|A8RUX8|A8RUX8_9CLOT Putative uncharacterized protein
OS=Clostridium bolteae ATCC BAA-613 GN=CLOBOL_04153 PE=4
SV=1
Length = 385

Score = 33.1 bits (74), Expect = 7.0
Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 9/63 (14%)
Frame = -1

Query: 346 RLESLCN--HVLQF*N-LSLDMVFPDSKHLTVEKVNQ------VTSHAVRVSDEVGGLKM 194
RL LC+ HVL F + + D+VFP KH+ + VNQ VT+ A + + GLK
Sbjct: 184 RLNDLCSRYHVLVFSDEIHSDLVFPGHKHIPYQTVNQDAAGRSVTAMAPSKTFNIAGLKS 243

Query: 193 LLL 185
+L
Sbjct: 244 SVL 246


>tr|A8BKC0|A8BKC0_GIALA Putative uncharacterized protein OS=Giardia
lamblia ATCC 50803 GN=GL50803_17332 PE=4 SV=1
Length = 1656

Score = 33.1 bits (74), Expect = 7.0
Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
Frame = -2

Query: 141 VVWPLGSHDRVITFAPPIMSRSA--CVILHCPCGVHVIFYQHEGWYFL 4
+VWP+ D +T + + + + C+I +CP H IF +G Y L
Sbjct: 186 IVWPISQKDERVTNSKTLKIKESEYCLISYCPYDNHFIFSDDKGLYSL 233


>tr|B8JJ82|B8JJ82_MOUSE Novel protein (2810055F11Rik) OS=Mus
musculus GN=RP23-301G24.1 PE=4 SV=1
Length = 354

Score = 32.7 bits (73), Expect = 9.2
Identities = 14/28 (50%), Positives = 18/28 (64%)
Frame = -2

Query: 99 APPIMSRSACVILHCPCGVHVIFYQHEG 16
APP +R A V +HCPCG+ F + EG
Sbjct: 123 APPKGAREAQVNIHCPCGLVTAFVECEG 150


>tr|B6K9W5|B6K9W5_TOXGO Helicase, putative OS=Toxoplasma gondii ME49
GN=TGME49_116750 PE=4 SV=1
Length = 741

Score = 32.7 bits (73), Expect = 9.2
Identities = 15/38 (39%), Positives = 19/38 (50%)
Frame = +1

Query: 241 LPDSLSRLSNACCLEKPCPKKGFKTVAHGCREIPDASS 354
LP RLSN C+ P + G + +H CRE P S
Sbjct: 243 LPTPAGRLSNCRCMRSPTRRVGLRLRSHICREEPRGES 280