BP914082
Clone id YMU001_000039_F07
Library
Length 608
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000039_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCACTTGTTAGTTTACAAGGTTCAACAACAGCCGCAAATCTCATGTACAAGAAATGTCTG
CTCCTCTGACTCTTGAATAATTCATGGGCCTTAACACCTTCTTTTCTCCACTCAAATCTT
TCTGGTAAGAGGGGATCCGTAATATACAAATTCTGAAGTCAAAAAATTGGTTCCTAATGA
GCCACTACAGCCTTTAGTTCTACAAACTCTGTACAAAAAGCCAGAAAATATTTACTGACG
AGTATCTGTAGATTACAACACCACTAGGAAAAGCATCTTCTCTTCTGGATCAGATCATTC
AATAAATGCTTTTCACCTGAAGGGTCATCTAAAAATAGTTAGCCTAACCCCTTCTTGCTA
TTGTTCTTTGAATGGGGTCCAAATCAATTTTGTTGGATCTACCTCCAAACCCCCTTTCCC
GGCAGCCTTCAAATGGCGCTCCAAGAGCTTAGGATCTGCACATATAACGTGTTGACCTTT
TCGATATTGAATCAGCTCAAGTGACTGAAGAGTGCTGATGACATCTTCCGTCTTGATGGC
CGTCATATCGCTGAGCTCCTTGATGGATAGATTTCCTCTGTGTTTCTTGATTACATCCAA
AAGAACCC
■■Homology search results ■■ -
sp_hit_id Q9FLF7
Definition sp|Q9FLF7|MYST1_ARATH Probable MYST-like histone acetyltransferase 1 OS=Arabidopsis thaliana
Align length 82
Score (bit) 147.0
E-value 5.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914082|Adiantum capillus-veneris mRNA, clone:
YMU001_000039_F07.
(608 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FLF7|MYST1_ARATH Probable MYST-like histone acetyltransfera... 147 5e-35
sp|Q9LXD7|MYST2_ARATH MYST-like histone acetyltransferase 2 OS=A... 144 4e-34
sp|Q8LI34|MYST1_ORYSJ Putative MYST-like histone acetyltransfera... 143 8e-34
sp|Q5XI06|MYST1_RAT Probable histone acetyltransferase MYST1 OS=... 88 3e-17
sp|Q9D1P2|MYST1_MOUSE Probable histone acetyltransferase MYST1 O... 88 3e-17
sp|Q9H7Z6|MYST1_HUMAN Probable histone acetyltransferase MYST1 O... 88 3e-17
sp|Q960X4|TIP60_DROME Histone acetyltransferase Tip60 OS=Drosoph... 66 1e-10
sp|Q08649|ESA1_YEAST Histone acetyltransferase ESA1 OS=Saccharom... 65 4e-10
sp|Q6FPH9|ESA1_CANGA Histone acetyltransferase ESA1 OS=Candida g... 64 6e-10
sp|Q6CKE9|ESA1_KLULA Histone acetyltransferase ESA1 OS=Kluyverom... 60 7e-09
sp|Q75BY2|ESA1_ASHGO Histone acetyltransferase ESA1 OS=Ashbya go... 60 7e-09
sp|O02193|MOF_DROME Males-absent on the first protein OS=Drosoph... 60 9e-09
sp|Q99MK2|TIP60_RAT Histone acetyltransferase HTATIP OS=Rattus n... 58 3e-08
sp|Q5RBG4|TIP60_PONAB Histone acetyltransferase HTATIP OS=Pongo ... 58 3e-08
sp|Q8CHK4|TIP60_MOUSE Histone acetyltransferase HTATIP OS=Mus mu... 58 3e-08
sp|Q92993|TIP60_HUMAN Histone acetyltransferase HTATIP OS=Homo s... 58 3e-08
sp|Q810T5|MYST2_RAT Histone acetyltransferase MYST2 OS=Rattus no... 55 3e-07
sp|Q5SVQ0|MYST2_MOUSE Histone acetyltransferase MYST2 OS=Mus mus... 55 3e-07
sp|O95251|MYST2_HUMAN Histone acetyltransferase MYST2 OS=Homo sa... 55 3e-07
sp|Q6C710|ESA1_YARLI Histone acetyltransferase ESA1 OS=Yarrowia ... 55 3e-07
sp|Q6BU95|ESA1_DEBHA Histone acetyltransferase ESA1 OS=Debaryomy... 53 1e-06
sp|Q9TYU5|TIP60_CAEEL Histone acetyltransferase Tip60 homolog OS... 52 2e-06
sp|Q5A7Q2|ESA1_CANAL Histone acetyltransferase ESA1 OS=Candida a... 49 2e-05
sp|Q4IEV4|ESA1_GIBZE Histone acetyltransferase ESA1 OS=Gibberell... 49 2e-05
sp|Q92794|MYST3_HUMAN Histone acetyltransferase MYST3 OS=Homo sa... 48 3e-05
sp|Q5KM33|ESA1_CRYNE Histone acetyltransferase ESA1 OS=Cryptococ... 48 3e-05
sp|Q5TKR9|MYST3_RAT Histone acetyltransferase MYST3 OS=Rattus no... 48 4e-05
sp|Q8BZ21|MYST3_MOUSE Histone acetyltransferase MYST3 OS=Mus mus... 48 4e-05
sp|Q8WYB5|MYST4_HUMAN Histone acetyltransferase MYST4 OS=Homo sa... 47 6e-05
sp|Q7S9B6|ESA1_NEUCR Histone acetyltransferase esa-1 OS=Neurospo... 47 1e-04

>sp|Q9FLF7|MYST1_ARATH Probable MYST-like histone acetyltransferase
1 OS=Arabidopsis thaliana GN=HAG4 PE=2 SV=1
Length = 445

Score = 147 bits (370), Expect = 5e-35
Identities = 66/82 (80%), Positives = 80/82 (97%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
+LLD++KKH+GN+SIKELSDMTAIK ED++STLQSLELIQYRKGQHVICADPK+L+RHLK
Sbjct: 363 ILLDILKKHKGNISIKELSDMTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRHLK 422

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGL+VD +K+IWTP+KEQ
Sbjct: 423 AAGRGGLDVDVSKMIWTPYKEQ 444


>sp|Q9LXD7|MYST2_ARATH MYST-like histone acetyltransferase 2
OS=Arabidopsis thaliana GN=HAG5 PE=2 SV=1
Length = 445

Score = 144 bits (363), Expect = 4e-34
Identities = 65/82 (79%), Positives = 80/82 (97%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL+++KKH+GN+SIKELSD+TAIK ED++STLQSLELIQYRKGQHVICADPK+L+RHLK
Sbjct: 363 VLLEILKKHKGNISIKELSDVTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRHLK 422

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGL+VD +KLIWTP+K+Q
Sbjct: 423 AAGRGGLDVDASKLIWTPYKDQ 444


>sp|Q8LI34|MYST1_ORYSJ Putative MYST-like histone acetyltransferase
1 OS=Oryza sativa subsp. japonica GN=Os07g0626600 PE=3
SV=1
Length = 450

Score = 143 bits (360), Expect = 8e-34
Identities = 65/82 (79%), Positives = 79/82 (96%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL+++KKH+ N+SIKELSDMTAIK +D++STLQSL+LIQYRKGQHVICADPK+L+RHLK
Sbjct: 368 VLLEILKKHKSNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLK 427

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGLEVD +KLIWTP+KEQ
Sbjct: 428 AAGRGGLEVDVSKLIWTPYKEQ 449


>sp|Q5XI06|MYST1_RAT Probable histone acetyltransferase MYST1
OS=Rattus norvegicus GN=Myst1 PE=2 SV=1
Length = 458

Score = 88.2 bits (217), Expect = 3e-17
Identities = 45/84 (53%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL++++ RG LSIK+LS MT+I D+ISTLQSL +++Y KGQHVIC PKL+E HLK
Sbjct: 368 VLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLK 427

Query: 426 AA--GKGGLEVDPTKLIWTPFKEQ 361
+A K + VD L W P K +
Sbjct: 428 SAQYKKPPITVDSVCLKWAPPKHK 451


>sp|Q9D1P2|MYST1_MOUSE Probable histone acetyltransferase MYST1
OS=Mus musculus GN=Myst1 PE=1 SV=1
Length = 458

Score = 88.2 bits (217), Expect = 3e-17
Identities = 45/84 (53%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL++++ RG LSIK+LS MT+I D+ISTLQSL +++Y KGQHVIC PKL+E HLK
Sbjct: 368 VLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLK 427

Query: 426 AA--GKGGLEVDPTKLIWTPFKEQ 361
+A K + VD L W P K +
Sbjct: 428 SAQYKKPPITVDSVCLKWAPPKHK 451


>sp|Q9H7Z6|MYST1_HUMAN Probable histone acetyltransferase MYST1
OS=Homo sapiens GN=MYST1 PE=1 SV=2
Length = 458

Score = 88.2 bits (217), Expect = 3e-17
Identities = 45/84 (53%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL++++ RG LSIK+LS MT+I D+ISTLQSL +++Y KGQHVIC PKL+E HLK
Sbjct: 368 VLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLK 427

Query: 426 AA--GKGGLEVDPTKLIWTPFKEQ 361
+A K + VD L W P K +
Sbjct: 428 SAQYKKPPITVDSVCLKWAPPKHK 451


>sp|Q960X4|TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila
melanogaster GN=Tip60 PE=1 SV=1
Length = 541

Score = 66.2 bits (160), Expect = 1e-10
Identities = 29/66 (43%), Positives = 46/66 (69%)
Frame = -3

Query: 570 LSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLKAAGKGGLEVDPT 391
++I ++ + T+IK EDVISTLQ+L LI Y KGQ+++C + ++E+H +A K + +D
Sbjct: 468 ITINDICECTSIKKEDVISTLQNLNLINYYKGQYIVCINRVIIEQHRRAMDKRKIRIDSK 527

Query: 390 KLIWTP 373
L WTP
Sbjct: 528 CLHWTP 533


>sp|Q08649|ESA1_YEAST Histone acetyltransferase ESA1
OS=Saccharomyces cerevisiae GN=ESA1 PE=1 SV=1
Length = 445

Score = 64.7 bits (156), Expect = 4e-10
Identities = 26/77 (33%), Positives = 51/77 (66%)
Frame = -3

Query: 603 LLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLKA 424
L+ ++ +H+ ++I E+S MT++ T D++ T ++L +++Y KGQH+I + +L+R+ +
Sbjct: 357 LITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRL 416

Query: 423 AGKGGLEVDPTKLIWTP 373
K +DP +LIW P
Sbjct: 417 KAKKRRTIDPNRLIWKP 433


>sp|Q6FPH9|ESA1_CANGA Histone acetyltransferase ESA1 OS=Candida
glabrata GN=ESA1 PE=3 SV=1
Length = 446

Score = 63.9 bits (154), Expect = 6e-10
Identities = 28/78 (35%), Positives = 51/78 (65%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VL+ ++ +H ++I E+S MT++ T D++ TL++L +++Y KGQH+I + +LER+ +
Sbjct: 357 VLITLLVEHGKEVTIDEISSMTSMTTTDILHTLKTLNILRYYKGQHIIFLNDDILERYNQ 416

Query: 426 AAGKGGLEVDPTKLIWTP 373
K +D KL+W P
Sbjct: 417 LKTKKRRHIDAEKLLWKP 434


>sp|Q6CKE9|ESA1_KLULA Histone acetyltransferase ESA1
OS=Kluyveromyces lactis GN=ESA1 PE=3 SV=1
Length = 439

Score = 60.5 bits (145), Expect = 7e-09
Identities = 24/77 (31%), Positives = 51/77 (66%)
Frame = -3

Query: 603 LLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLKA 424
L+ ++ +H ++I E+S ++++ T D++ T ++LE++++ +GQHV+ + +++R+ K
Sbjct: 351 LIKLLVEHGQEITIDEVSSISSMTTTDILHTAKALEILRFYRGQHVLYLNSDVMKRYKKL 410

Query: 423 AGKGGLEVDPTKLIWTP 373
+DP KLIWTP
Sbjct: 411 KNNKRRSIDPQKLIWTP 427


tr_hit_id A9RJM4
Definition tr|A9RJM4|A9RJM4_PHYPA Histone acetyltransferase OS=Physcomitrella patens subsp. patens
Align length 82
Score (bit) 152.0
E-value 2.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914082|Adiantum capillus-veneris mRNA, clone:
YMU001_000039_F07.
(608 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RJM4|A9RJM4_PHYPA Histone acetyltransferase OS=Physcomitrel... 152 2e-35
tr|O80378|O80378_DAUCA 181 (Fragment) OS=Daucus carota GN=181-1d... 148 3e-34
tr|A7NV61|A7NV61_VITVI Chromosome chr18 scaffold_1, whole genome... 148 3e-34
tr|Q6V9I3|Q6V9I3_SOLCH MYST-type acetyltransferase (Fragment) OS... 147 4e-34
tr|Q8W513|Q8W513_MAIZE Histone aceytl-transferase HAC108 (Putati... 144 4e-33
tr|Q8L818|Q8L818_MAIZE Histone acetyltransferase protein HAC108 ... 144 4e-33
tr|Q0D4H1|Q0D4H1_ORYSJ Os07g0626600 protein OS=Oryza sativa subs... 143 9e-33
tr|A3BME4|A3BME4_ORYSJ Putative uncharacterized protein OS=Oryza... 143 9e-33
tr|A2YNW7|A2YNW7_ORYSI Putative uncharacterized protein OS=Oryza... 143 9e-33
tr|Q0Z9W0|Q0Z9W0_WHEAT Histone acetyltransferase HAT1 OS=Triticu... 142 2e-32
tr|A9NUX9|A9NUX9_PICSI Putative uncharacterized protein OS=Picea... 140 4e-32
tr|A8J386|A8J386_CHLRE MYST family histone acetyltransferase OS=... 109 1e-22
tr|B0G130|B0G130_DICDI HAM group protein OS=Dictyostelium discoi... 96 1e-18
tr|A4S305|A4S305_OSTLU Predicted protein OS=Ostreococcus lucimar... 94 8e-18
tr|Q010Z9|Q010Z9_OSTTA Histone aceytl-transferase HAC108 (ISS) O... 92 2e-17
tr|Q869X5|Q869X5_DICDI Similar to Oryza sativa (Japonica cultiva... 91 4e-17
tr|B7Q9K5|B7Q9K5_IXOSC Myst histone acetyltransferase, putative ... 91 5e-17
tr|A9T381|A9T381_PHYPA Histone acetyltransferase OS=Physcomitrel... 89 2e-16
tr|A7S8T4|A7S8T4_NEMVE Predicted protein OS=Nematostella vectens... 89 3e-16
tr|Q4SAS3|Q4SAS3_TETNG Chromosome 3 SCAF14679, whole genome shot... 88 3e-16
tr|Q3V268|Q3V268_MOUSE Putative uncharacterized protein OS=Mus m... 88 3e-16
tr|A3KN50|A3KN50_BOVIN MYST1 protein OS=Bos taurus GN=MYST1 PE=2... 88 3e-16
tr|A8K4Z1|A8K4Z1_HUMAN cDNA FLJ78028 OS=Homo sapiens GN=MYST1 PE... 88 3e-16
tr|Q28CP4|Q28CP4_XENTR Myst histone acetyltransferase 2 OS=Xenop... 87 6e-16
tr|B7ZU40|B7ZU40_XENTR Myst1 protein OS=Xenopus tropicalis GN=my... 87 6e-16
tr|A9JTB7|A9JTB7_DANRE MYST histone acetyltransferase 1 OS=Danio... 87 6e-16
tr|Q7SXF3|Q7SXF3_DANRE MYST histone acetyltransferase 1 OS=Danio... 86 2e-15
tr|A5JPL6|A5JPL6_BOMMO MOF protein OS=Bombyx mori PE=2 SV=1 83 1e-14
tr|A4K580|A4K580_BOMMO Putative MYST histone acetyltransferase (... 83 1e-14
tr|A4S2G8|A4S2G8_OSTLU Predicted protein OS=Ostreococcus lucimar... 82 3e-14

>tr|A9RJM4|A9RJM4_PHYPA Histone acetyltransferase OS=Physcomitrella
patens subsp. patens GN=HAM1501 PE=4 SV=1
Length = 404

Score = 152 bits (383), Expect = 2e-35
Identities = 71/82 (86%), Positives = 81/82 (98%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
+LLD++KKHRGN+SIKELSDMTAIKTEDVI+TLQ+LELIQYRKGQHVICADPKLLERHLK
Sbjct: 321 ILLDILKKHRGNVSIKELSDMTAIKTEDVITTLQTLELIQYRKGQHVICADPKLLERHLK 380

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGL+VD +KLIWTP+KEQ
Sbjct: 381 AAGRGGLDVDASKLIWTPYKEQ 402


>tr|O80378|O80378_DAUCA 181 (Fragment) OS=Daucus carota GN=181-1d10
PE=2 SV=1
Length = 433

Score = 148 bits (373), Expect = 3e-34
Identities = 68/82 (82%), Positives = 80/82 (97%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLLD++KKH+GN+SIKELSDMTAIK ED+++TLQSLELIQYRKGQHVICADPK+L+RHLK
Sbjct: 351 VLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLK 410

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGLEVD +KLIWTP+KEQ
Sbjct: 411 AAGRGGLEVDVSKLIWTPYKEQ 432


>tr|A7NV61|A7NV61_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015313001
PE=4 SV=1
Length = 439

Score = 148 bits (373), Expect = 3e-34
Identities = 68/82 (82%), Positives = 80/82 (97%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLLD++KKH+GN+SIKELSDMTAIK ED+++TLQSLELIQYRKGQHVICADPK+L+RHLK
Sbjct: 357 VLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLK 416

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGLEVD +KLIWTP+KEQ
Sbjct: 417 AAGRGGLEVDVSKLIWTPYKEQ 438


>tr|Q6V9I3|Q6V9I3_SOLCH MYST-type acetyltransferase (Fragment)
OS=Solanum chacoense PE=2 SV=1
Length = 442

Score = 147 bits (372), Expect = 4e-34
Identities = 68/82 (82%), Positives = 79/82 (96%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLLD++KKH+GN+SIKELSDMTAIK ED++STLQ LELIQYRKGQHVICADPK+L+RHLK
Sbjct: 360 VLLDILKKHKGNISIKELSDMTAIKAEDILSTLQGLELIQYRKGQHVICADPKVLDRHLK 419

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGLEVD +KLIWTP+KEQ
Sbjct: 420 AAGRGGLEVDVSKLIWTPYKEQ 441


>tr|Q8W513|Q8W513_MAIZE Histone aceytl-transferase HAC108 (Putative
uncharacterized protein) OS=Zea mays GN=hac108 PE=2 SV=1
Length = 444

Score = 144 bits (363), Expect = 4e-33
Identities = 65/82 (79%), Positives = 80/82 (97%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL+++KKH+GN+SIKELSDMTAIK +D++STLQSL+LIQYRKGQHVICADPK+L+RHLK
Sbjct: 362 VLLEILKKHKGNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLK 421

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGL+VD +KLIWTP+KEQ
Sbjct: 422 AAGRGGLDVDVSKLIWTPYKEQ 443


>tr|Q8L818|Q8L818_MAIZE Histone acetyltransferase protein HAC108
OS=Zea mays GN=HAC108 PE=2 SV=1
Length = 444

Score = 144 bits (363), Expect = 4e-33
Identities = 65/82 (79%), Positives = 80/82 (97%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL+++KKH+GN+SIKELSDMTAIK +D++STLQSL+LIQYRKGQHVICADPK+L+RHLK
Sbjct: 362 VLLEILKKHKGNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLK 421

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGL+VD +KLIWTP+KEQ
Sbjct: 422 AAGRGGLDVDVSKLIWTPYKEQ 443


>tr|Q0D4H1|Q0D4H1_ORYSJ Os07g0626600 protein OS=Oryza sativa subsp.
japonica GN=Os07g0626600 PE=4 SV=1
Length = 450

Score = 143 bits (360), Expect = 9e-33
Identities = 65/82 (79%), Positives = 79/82 (96%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL+++KKH+ N+SIKELSDMTAIK +D++STLQSL+LIQYRKGQHVICADPK+L+RHLK
Sbjct: 368 VLLEILKKHKSNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLK 427

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGLEVD +KLIWTP+KEQ
Sbjct: 428 AAGRGGLEVDVSKLIWTPYKEQ 449


>tr|A3BME4|A3BME4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_024216 PE=4 SV=1
Length = 381

Score = 143 bits (360), Expect = 9e-33
Identities = 65/82 (79%), Positives = 79/82 (96%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL+++KKH+ N+SIKELSDMTAIK +D++STLQSL+LIQYRKGQHVICADPK+L+RHLK
Sbjct: 299 VLLEILKKHKSNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLK 358

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGLEVD +KLIWTP+KEQ
Sbjct: 359 AAGRGGLEVDVSKLIWTPYKEQ 380


>tr|A2YNW7|A2YNW7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26946 PE=4 SV=1
Length = 450

Score = 143 bits (360), Expect = 9e-33
Identities = 65/82 (79%), Positives = 79/82 (96%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL+++KKH+ N+SIKELSDMTAIK +D++STLQSL+LIQYRKGQHVICADPK+L+RHLK
Sbjct: 368 VLLEILKKHKSNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLK 427

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGLEVD +KLIWTP+KEQ
Sbjct: 428 AAGRGGLEVDVSKLIWTPYKEQ 449


>tr|Q0Z9W0|Q0Z9W0_WHEAT Histone acetyltransferase HAT1 OS=Triticum
aestivum PE=2 SV=1
Length = 435

Score = 142 bits (357), Expect = 2e-32
Identities = 64/82 (78%), Positives = 79/82 (96%)
Frame = -3

Query: 606 VLLDVIKKHRGNLSIKELSDMTAIKTEDVISTLQSLELIQYRKGQHVICADPKLLERHLK 427
VLL+++KKH+ N+SIKELSDMTAIK +D++STLQSL+LIQYRKGQHVICADPK+L+RHLK
Sbjct: 353 VLLEILKKHKSNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLK 412

Query: 426 AAGKGGLEVDPTKLIWTPFKEQ 361
AAG+GGL+VD +KLIWTP+KEQ
Sbjct: 413 AAGRGGLDVDVSKLIWTPYKEQ 434