BP914087
Clone id YMU001_000039_F12
Library
Length 619
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000039_F12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTGTAGCAGACACATCCTTCCAACCTCCTGTCCTCCAATCTCCTACTGAGCATCATAAGC
TCTTGACCCTGATTAATCTCTGAATTTCCACTCTCACCCTTGGGCAGTCCAGATTTCAAT
GTACAAAGCTCTCTTTCTGCCTGCAGCCTCAATTGACTTTCATTCTCTAGCTGCAGCTTC
AACTCCAAAACCTCATCAGTGAGCTGCTTGCACGGGTCAGATGCATCGTTGTGATGTTGC
ATGGCTGCCAGAAGTTCACTTTCCATTCGCTGCCTTTCTATTCGTTCACTTTCAAGGTTC
TGCAATGCCTCCACTTGTTCCTTCTGATATCTGACCCTTTCTGCTGCCATTTTCTCCAAT
GCACTTTCTAGATTCTTTTCAGCTCTTCGCGCTTCTTCAAGTCTTTCTTGTAGCTTTTCC
TCAACATCCAGCAAAAGCTTTGCTTGCCTCTCAATCTCTGTAGTGCGCCTTTCCAACTCC
ATCCCCAGCCTGCGGTACAGGCTCTTGTAATCAAACTCTTCTTTCAACTTCACCATGTTC
TCAACTTTCATTGCTCGTTGACCGAACATGATGGTGCTTGTTGTTTCCCCACGATGTCGA
GGTGAAGGCCCAATTGTTA
■■Homology search results ■■ -
sp_hit_id Q9FZ06
Definition sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana
Align length 212
Score (bit) 126.0
E-value 1.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914087|Adiantum capillus-veneris mRNA, clone:
YMU001_000039_F12.
(619 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like pr... 126 1e-28
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like pr... 116 8e-26
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like pr... 110 4e-24
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like pr... 96 2e-19
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like pr... 86 1e-16
sp|P21613|KINH_LOLPE Kinesin heavy chain OS=Loligo pealeii PE=2 ... 48 5e-05
sp|Q6QLM7|KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus nor... 47 6e-05
sp|P33175|KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musc... 47 8e-05
sp|Q12840|KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sap... 47 1e-04
sp|Q9JI55|PLEC1_CRIGR Plectin-1 (Fragment) OS=Cricetulus griseus... 46 2e-04
sp|Q5R9K7|KIF5A_PONAB Kinesin heavy chain isoform 5A OS=Pongo ab... 45 3e-04
sp|Q15149|PLEC1_HUMAN Plectin-1 OS=Homo sapiens GN=PLEC1 PE=1 SV=3 45 4e-04
sp|Q9QXS1|PLEC1_MOUSE Plectin-1 OS=Mus musculus GN=Plec1 PE=1 SV=2 44 9e-04
sp|P30427|PLEC1_RAT Plectin-1 OS=Rattus norvegicus GN=Plec1 PE=1... 43 0.001
sp|Q7TSG1|CE120_MOUSE Centrosomal protein of 120 kDa OS=Mus musc... 40 0.007
sp|Q8N960|CE120_HUMAN Centrosomal protein of 120 kDa OS=Homo sap... 40 0.007
sp|Q61768|KINH_MOUSE Kinesin-1 heavy chain OS=Mus musculus GN=Ki... 40 0.013
sp|Q2PQA9|KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus GN... 39 0.016
sp|A0JN62|CE120_BOVIN Centrosomal protein of 120 kDa OS=Bos taur... 39 0.016
sp|P34011|ATI1_VARV 81 kDa A-type inclusion protein OS=Variola v... 39 0.016
sp|Q29RW1|MYH4_RAT Myosin-4 OS=Rattus norvegicus GN=Myh4 PE=2 SV=1 39 0.028
sp|Q5SX39|MYH4_MOUSE Myosin-4 OS=Mus musculus GN=Myh4 PE=2 SV=1 39 0.028
sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1... 39 0.028
sp|A4IX27|GRPE_FRATW Protein grpE OS=Francisella tularensis subs... 38 0.037
sp|P48204|GRPE_FRATU Protein grpE OS=Francisella tularensis GN=g... 38 0.037
sp|Q5NFG6|GRPE_FRATT Protein grpE OS=Francisella tularensis subs... 38 0.037
sp|Q0BLK5|GRPE_FRATO Protein grpE OS=Francisella tularensis subs... 38 0.037
sp|A0Q7F1|GRPE_FRATN Protein grpE OS=Francisella tularensis subs... 38 0.037
sp|Q2A329|GRPE_FRATH Protein grpE OS=Francisella tularensis subs... 38 0.037
sp|A7NCM8|GRPE_FRATF Protein grpE OS=Francisella tularensis subs... 38 0.037

>sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein
3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1
Length = 919

Score = 126 bits (316), Expect = 1e-28
Identities = 87/212 (41%), Positives = 124/212 (58%), Gaps = 11/212 (5%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGETTSTIMFGQRAMKVENMVK+KEEFDYKSL RRL ++L+ E ERQ K
Sbjct: 388 TIGPSPRHRGETTSTIMFGQRAMKVENMVKIKEEFDYKSLSRRLEVQLDNLIEENERQQK 447

Query: 437 LLLD-VXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQ-RM 264
+D + +ALE E++RYQ + +E+++ LE + Q ++
Sbjct: 448 AFVDEIERITVEAHNQISEAEKRYANALED---EKLRYQNDYMESIKKLEENWSKNQKKL 504

Query: 263 ESELLAAMQHH-----NDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKSGLPK 99
+E LA + + ++ + +EV ELK L+ E+Q ++ AE E+ LK L +
Sbjct: 505 AAERLALGEKNGLDITSNGNRSIAPALEEVSELKKLLQKEAQSKMAAEEEVNRLKHQLNE 564

Query: 98 GE----SGNSEINQGQELMMLSRRLEDRRLEG 15
+ SGNSEI + + M+ + + +LEG
Sbjct: 565 FKKVEASGNSEIMRLHK-MLENETQQKEKLEG 595


>sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like
protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2
Length = 894

Score = 116 bits (291), Expect = 8e-26
Identities = 84/205 (40%), Positives = 108/205 (52%), Gaps = 5/205 (2%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGETTSTI+FGQRAMKVENM+K+KEEFDYKSL ++L ++L++ E ERQ K
Sbjct: 378 TIGPSPRHRGETTSTILFGQRAMKVENMLKIKEEFDYKSLSKKLEVQLDKVIAENERQLK 437

Query: 437 LL-LDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRME 261
DV ALEK E+++ Q E +E+++ LE + I QR
Sbjct: 438 AFDDDVERINRQAQNRISEVEKNFAEALEK---EKLKCQMEYMESVKKLEEKLISNQR-- 492

Query: 260 SELLAAMQHHNDASDPCKQ---LTDEVLELKLQLENESQLRLQAERELCTLKS-GLPKGE 93
H N + E LK LENE +LR AE E+ +KS K
Sbjct: 493 -------NHENGKRNGEVNGVVTASEFTRLKESLENEMKLRKSAEEEVSKVKSQSTLKTR 545

Query: 92 SGNSEINQGQELMMLSRRLEDRRLE 18
SG E + L + LED L+
Sbjct: 546 SGEGE---DAGITRLQKLLEDEALQ 567


>sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like
protein 2 OS=Oryza sativa subsp. japonica
GN=Os06g0137100 PE=2 SV=1
Length = 891

Score = 110 bits (276), Expect = 4e-24
Identities = 73/170 (42%), Positives = 97/170 (57%), Gaps = 1/170 (0%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSL RRL +EL++ E ERQ K
Sbjct: 376 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLCRRLDIELDKLIAENERQRK 435

Query: 437 LLLD-VXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRME 261
D + + +LE E+ +Y +E +++++ LE + Q+
Sbjct: 436 YFDDEIERITAEAQLRVTEAEREYKISLEN---EKAKYHQEYLDSIKILEEKWKIHQQSP 492

Query: 260 SELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKS 111
+L+ + + EV E++ L+NE LR AE E LK+
Sbjct: 493 KKLIKETE----------PTSSEVGEVQNLLQNEKVLRQSAEDEANDLKN 532


>sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like
protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2
Length = 1051

Score = 95.5 bits (236), Expect = 2e-19
Identities = 61/159 (38%), Positives = 84/159 (52%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPS R+ ETTSTIMFGQRAMK+ NMVKLKEEFDY+SL R+L +++ T E+ERQ K
Sbjct: 417 TIGPSARYHAETTSTIMFGQRAMKIVNMVKLKEEFDYESLCRKLETQVDHLTAEVERQNK 476

Query: 437 LLLDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRMES 258
L E L + +K V + LE E +
Sbjct: 477 L--------------RNSEKHELEKRLRECENSFAEAEKNAVTRSKFLEKENTRLELSMK 522

Query: 257 ELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQ 141
ELL +Q D C + D+ ++L+++L+N Q +L+
Sbjct: 523 ELLKDLQLQ---KDQCDLMHDKAIQLEMKLKNTKQQQLE 558


>sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like
protein 1 OS=Oryza sativa subsp. japonica
GN=Os03g0152900 PE=2 SV=2
Length = 945

Score = 86.3 bits (212), Expect = 1e-16
Identities = 53/165 (32%), Positives = 87/165 (52%), Gaps = 6/165 (3%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPS RH ET+STIMFGQRAMK+ N +++KEE DY+SLY+++ E++ T+E+ERQ K
Sbjct: 375 TIGPSSRHFSETSSTIMFGQRAMKIVNTIRIKEEVDYESLYKKVEHEVDHLTSEMERQQK 434

Query: 437 LLLDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKE------QVEALQNLESERIE 276
L EKM E+ + E +V + +E+ +E
Sbjct: 435 L-----------------------KNSEKMQLEKKLKESEASLNDLKVTSNMQIENMAME 471

Query: 275 RQRMESELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQ 141
++++ES + M L+++++ L+ L+ Q +L+
Sbjct: 472 KRQLESTIKRLMLDLEKEKGKNNILSEQIIHLETSLDENKQKQLE 516


>sp|P21613|KINH_LOLPE Kinesin heavy chain OS=Loligo pealeii PE=2
SV=1
Length = 967

Score = 47.8 bits (112), Expect = 5e-05
Identities = 50/209 (23%), Positives = 82/209 (39%), Gaps = 12/209 (5%)
Frame = -3

Query: 608 PSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAKLLL 429
P+ + ET ST++FGQRA ++N+V + EE RR E ER T AKL
Sbjct: 305 PASYNESETKSTLLFGQRAKTIKNVVSVNEELTADEWKRRYEKEKERVTKLKATMAKLEA 364

Query: 428 DVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRMESELL 249
++ E + AE + +R ++E E L
Sbjct: 365 EL----QRWRTGQAVSVEEQVDLKEDVPAESPATSTTSLAGGLIASMNEGDRTQLEEERL 420

Query: 248 AAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKSGLPK----GESGNS 81
Q +D D + + +LK Q+ + L Q+ R+ L+ + + ES
Sbjct: 421 KLYQQLDDKDDEINNQSQLIEKLKEQMMEQEDLIAQSRRDYENLQQDMSRIQADNESAKD 480

Query: 80 EINQG----QELMM----LSRRLEDRRLE 18
E+ + +EL M S+ +ED+ E
Sbjct: 481 EVKEVLQALEELAMNYDQKSQEVEDKNKE 509


>sp|Q6QLM7|KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus
norvegicus GN=Kif5a PE=1 SV=1
Length = 1027

Score = 47.4 bits (111), Expect = 6e-05
Identities = 46/204 (22%), Positives = 85/204 (41%), Gaps = 7/204 (3%)
Frame = -3

Query: 608 PSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAKLLL 429
PS + ET ST+MFGQRA ++N + E + ++ E E+ + E AKL
Sbjct: 306 PSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETIAKLEA 365

Query: 428 DVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRMESELL 249
++ +SAL E + + + E ERQ+ E E+
Sbjct: 366 ELSRWRNGENVPETERLAGEDSALAAEICEETPV-NDNSSIVVRIAPE--ERQKYEEEIR 422

Query: 248 AAMQHHNDASDPCKQLTDEVLELKLQLENESQLRL-------QAERELCTLKSGLPKGES 90
+ +D D Q + + +LK Q+ ++ +L + + +REL L+S +
Sbjct: 423 RLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAAKE 482

Query: 89 GNSEINQGQELMMLSRRLEDRRLE 18
E+ Q E + ++ + + +E
Sbjct: 483 EVKEVLQALEELAVNYDQKSQEVE 506


>sp|P33175|KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus
musculus GN=Kif5a PE=1 SV=3
Length = 1027

Score = 47.0 bits (110), Expect = 8e-05
Identities = 46/204 (22%), Positives = 85/204 (41%), Gaps = 7/204 (3%)
Frame = -3

Query: 608 PSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAKLLL 429
PS + ET ST+MFGQRA ++N + E + ++ E E+ + E AKL
Sbjct: 306 PSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETIAKLEA 365

Query: 428 DVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRMESELL 249
++ +SAL E + + + E ERQ+ E E+
Sbjct: 366 ELSRWRNGENVPETERLAGEDSALGAELCEETPV-NDNSSIVVRIAPE--ERQKYEEEIR 422

Query: 248 AAMQHHNDASDPCKQLTDEVLELKLQLENESQLRL-------QAERELCTLKSGLPKGES 90
+ +D D Q + + +LK Q+ ++ +L + + +REL L+S +
Sbjct: 423 RLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAAKD 482

Query: 89 GNSEINQGQELMMLSRRLEDRRLE 18
E+ Q E + ++ + + +E
Sbjct: 483 EVKEVLQALEELAVNYDQKSQEVE 506


>sp|Q12840|KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo
sapiens GN=KIF5A PE=1 SV=2
Length = 1032

Score = 46.6 bits (109), Expect = 1e-04
Identities = 47/211 (22%), Positives = 86/211 (40%), Gaps = 14/211 (6%)
Frame = -3

Query: 608 PSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAKLLL 429
PS + ET ST+MFGQRA ++N + E + ++ E E+ + E AKL
Sbjct: 306 PSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETIAKLEA 365

Query: 428 DVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERI-------ERQ 270
++ E++A E E E ++ I ERQ
Sbjct: 366 EL----------SRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQ 415

Query: 269 RMESELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRL-------QAERELCTLKS 111
+ E E+ + +D D Q + + +LK Q+ ++ +L + + +REL L+S
Sbjct: 416 KYEEEIRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQS 475

Query: 110 GLPKGESGNSEINQGQELMMLSRRLEDRRLE 18
+ E+ Q E + ++ + + +E
Sbjct: 476 ENDAAKDEVKEVLQALEELAVNYDQKSQEVE 506


>sp|Q9JI55|PLEC1_CRIGR Plectin-1 (Fragment) OS=Cricetulus griseus
GN=PLEC1 PE=1 SV=1
Length = 4473

Score = 45.8 bits (107), Expect = 2e-04
Identities = 48/202 (23%), Positives = 78/202 (38%), Gaps = 9/202 (4%)
Frame = -3

Query: 599 RHRGETTSTIMFGQRAMKVENMV-------KLKEEFDYKSLYRRLGMELERRTTEIERQA 441
+ R E + G+ A++ + + K + E + + L RR+ E+ RR
Sbjct: 1279 QQRAEERERLAEGEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVNAQ 1338

Query: 440 KLLLDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQR-- 267
+ + +E AAER R + E+ + L+ E ERQR
Sbjct: 1339 QQKRSIQEELQHLRQSSEAEIQAKAQQVE--AAERSRMRIEEEIRVVRLQLETTERQRGG 1396

Query: 266 MESELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKSGLPKGESG 87
E EL A +A +Q +E L+ Q+++ESQ + QAE EL +
Sbjct: 1397 AEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAQAEAAQE 1456

Query: 86 NSEINQGQELMMLSRRLEDRRL 21
Q E + L +RRL
Sbjct: 1457 KQRALQALEELRLQAEEAERRL 1478


tr_hit_id A9RKE8
Definition tr|A9RKE8|A9RKE8_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 204
Score (bit) 134.0
E-value 4.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914087|Adiantum capillus-veneris mRNA, clone:
YMU001_000039_F12.
(619 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RKE8|A9RKE8_PHYPA Predicted protein (Fragment) OS=Physcomit... 134 4e-30
tr|A7QK89|A7QK89_VITVI Chromosome chr2 scaffold_112, whole genom... 130 6e-29
tr|A9RQJ1|A9RQJ1_PHYPA Predicted protein (Fragment) OS=Physcomit... 126 9e-28
tr|A9TPE1|A9TPE1_PHYPA Predicted protein (Fragment) OS=Physcomit... 126 1e-27
tr|A7PYA5|A7PYA5_VITVI Chromosome chr15 scaffold_37, whole genom... 120 6e-26
tr|A3B870|A3B870_ORYSJ Putative uncharacterized protein OS=Oryza... 110 5e-23
tr|A2Y909|A2Y909_ORYSI Putative uncharacterized protein OS=Oryza... 110 5e-23
tr|A5BIN7|A5BIN7_VITVI Putative uncharacterized protein OS=Vitis... 102 2e-20
tr|A7PI02|A7PI02_VITVI Chromosome chr13 scaffold_17, whole genom... 99 2e-19
tr|A3AE81|A3AE81_ORYSJ Putative uncharacterized protein OS=Oryza... 86 1e-15
tr|B8AND9|B8AND9_ORYSI Putative uncharacterized protein OS=Oryza... 85 3e-15
tr|A0E4F4|A0E4F4_PARTE Chromosome undetermined scaffold_78, whol... 63 2e-08
tr|A0DZM3|A0DZM3_PARTE Chromosome undetermined scaffold_70, whol... 61 6e-08
tr|Q4CPP1|Q4CPP1_TRYCR Kinesin, putative (Fragment) OS=Trypanoso... 57 7e-07
tr|Q237L2|Q237L2_TETTH Kinesin motor domain containing protein O... 52 3e-05
tr|Q00YT5|Q00YT5_OSTTA Kinesin, putative (ISS) OS=Ostreococcus t... 50 1e-04
tr|A0EFD0|A0EFD0_PARTE Chromosome undetermined scaffold_93, whol... 47 7e-04
tr|A4I5Y7|A4I5Y7_LEIIN Kinesin, putative OS=Leishmania infantum ... 47 0.001
tr|B7Z2M7|B7Z2M7_HUMAN cDNA FLJ53380, highly similar to Kinesin ... 47 0.001
tr|B2RCP3|B2RCP3_HUMAN cDNA, FLJ96188, highly similar to Homo sa... 47 0.001
tr|A6H8M5|A6H8M5_HUMAN Kinesin family member 5A OS=Homo sapiens ... 47 0.001
tr|Q86IE9|Q86IE9_DICDI Similar to C25A11.4b.p [Caenorhabditis el... 46 0.002
tr|Q552W4|Q552W4_DICDI Calponin homology (CH) domain-containing ... 46 0.002
tr|Q54C75|Q54C75_DICDI SNF2-related domain-containing protein OS... 46 0.002
tr|Q54XN9|Q54XN9_DICDI Putative uncharacterized protein OS=Dicty... 45 0.003
tr|B0I1S7|B0I1S7_HUMAN KIF5A variant protein OS=Homo sapiens PE=... 45 0.003
tr|Q54FB8|Q54FB8_DICDI Putative uncharacterized protein OS=Dicty... 45 0.004
tr|Q4Q6Y4|Q4Q6Y4_LEIMA Kinesin, putative OS=Leishmania major GN=... 45 0.004
tr|Q6S383|Q6S383_HUMAN Plectin 1 OS=Homo sapiens PE=1 SV=1 45 0.004
tr|Q6S382|Q6S382_HUMAN Plectin 2 OS=Homo sapiens PE=2 SV=1 45 0.004

>tr|A9RKE8|A9RKE8_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_115724 PE=3 SV=1
Length = 860

Score = 134 bits (337), Expect = 4e-30
Identities = 85/204 (41%), Positives = 120/204 (58%), Gaps = 4/204 (1%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSL RR+ EL+R E ERQ K
Sbjct: 324 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLCRRMEAELDRLVAENERQIK 383

Query: 437 LLLDVXXXXXXXXXXXXXXXXXXESALE-KMAAERVRYQKEQVEALQNLESERIER-QRM 264
+ L+ E+ L+ M + ++ QKE E ++ + E +++ ++
Sbjct: 384 IRLENDEELDRVVEESRQLVMEAETRLQTAMDVQNLKLQKEMTEKMEKHQKELMQQVEKH 443

Query: 263 ESELLAAMQHH-NDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKSGLPK-GES 90
+ EL A+++ + + E+ EL LENE Q R + E+EL + K+ + K G +
Sbjct: 444 QLELATALENEKREREHQSVGQSKEIAELSTLLENERQKREELEQELKSTKTQMSKRGVN 503

Query: 89 GNSEINQGQELMMLSRRLEDRRLE 18
G+ QG EL+ + RL++ E
Sbjct: 504 GSLTKQQGDELLTVRHRLDEELRE 527


>tr|A7QK89|A7QK89_VITVI Chromosome chr2 scaffold_112, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001024001
PE=3 SV=1
Length = 844

Score = 130 bits (327), Expect = 6e-29
Identities = 86/208 (41%), Positives = 116/208 (55%), Gaps = 12/208 (5%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGET+STIMFGQRAMKVENM+K+KEEFDYKSL RRL ++L++ E ERQ K
Sbjct: 313 TIGPSPRHRGETSSTIMFGQRAMKVENMLKIKEEFDYKSLSRRLEIQLDKLIVEHERQQK 372

Query: 437 LLLD-VXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRME 261
D V ALEK ER++YQ++ +++++ LE + + QR
Sbjct: 373 AFEDEVERITVETQNHISETERNYADALEK---ERLKYQEDYMQSIKKLEEQWVMNQRKH 429

Query: 260 SELLAAMQHHNDASD-------PCKQLTDEVLELKLQLENESQLRLQAERELCTLKSGLP 102
+D D P +E+ ELK L+NE+ LR E E+ LKS +
Sbjct: 430 GSERTTFGLKDDNFDKTLNGVVPVASAAEEIAELKKLLQNEASLRTATEEEVNNLKSQVV 489

Query: 101 KGE----SGNSEINQGQELMMLSRRLED 30
+ + +GNSEI + L + LED
Sbjct: 490 QWKRIEAAGNSEI------LKLRKMLED 511


>tr|A9RQJ1|A9RQJ1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_118031 PE=3 SV=1
Length = 845

Score = 126 bits (317), Expect = 9e-28
Identities = 86/200 (43%), Positives = 106/200 (53%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGETTSTI+FGQRAMKVENMVKLKEEFDYKSL RRL EL+R E ER K
Sbjct: 323 TIGPSPRHRGETTSTILFGQRAMKVENMVKLKEEFDYKSLCRRLETELDRMVAENERLVK 382

Query: 437 LLLDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRMES 258
D ES L +E E + ER R+R+E+
Sbjct: 383 SREDSEDECARQLDDARQDVYEAESKL-------AHALEELAETVALYMQERAHRERLEN 435

Query: 257 ELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKSGLPKGESGNSE 78
EL + + + A + + EV+ L+L LE + Q Q E+EL LKS + +
Sbjct: 436 ELASQRELFSMAIQSGEH-SSEVMSLRLSLEKQMQKNDQLEQELRALKSSASRKSMKGNI 494

Query: 77 INQGQELMMLSRRLEDRRLE 18
Q EL+ L +RLED E
Sbjct: 495 QKQSDELLTLRQRLEDELKE 514


>tr|A9TPE1|A9TPE1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_148565 PE=3 SV=1
Length = 833

Score = 126 bits (316), Expect = 1e-27
Identities = 84/201 (41%), Positives = 106/201 (52%), Gaps = 1/201 (0%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSL RR+ EL+R E ERQ K
Sbjct: 313 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLCRRMEAELDRLVAENERQVK 372

Query: 437 LLLDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRMES 258
++ + LEK +R + ++ E S
Sbjct: 373 ARMENDEELDRTSDNQSMEIAELRALLEKERQKRKQSDEQSSEI---------------S 417

Query: 257 ELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKSGLPK-GESGNS 81
EL A +Q ++ T EV EL+ LE E Q R Q E+EL K+ + K +G+
Sbjct: 418 ELRALLQSERQKIIQFEEQTIEVAELRTLLEGERQKREQLEQELRVAKTQMSKRSVNGSL 477

Query: 80 EINQGQELMMLSRRLEDRRLE 18
QG EL+ + RL++ E
Sbjct: 478 TRQQGDELLTVRHRLDEELRE 498


>tr|A7PYA5|A7PYA5_VITVI Chromosome chr15 scaffold_37, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026364001
PE=3 SV=1
Length = 872

Score = 120 bits (301), Expect = 6e-26
Identities = 80/197 (40%), Positives = 108/197 (54%), Gaps = 1/197 (0%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGET STI+FGQRAMKVENM+K+KEEFDYKSL RRL ++L++ E ERQ K
Sbjct: 358 TIGPSPRHRGETASTILFGQRAMKVENMLKIKEEFDYKSLSRRLDIQLDKLIAENERQQK 417

Query: 437 LL-LDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRME 261
+V ALEK ER++ Q E +E+++ LE + + Q+
Sbjct: 418 AFEEEVERITLEAQKRVSEVERNYADALEK---ERLKCQMEYMESVKQLEEKLVTNQKKW 474

Query: 260 SELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKSGLPKGESGNS 81
+ P +E+ E+K L+NE LR AE E+ LK+ L G+
Sbjct: 475 C----------NGEGPGVSGAEELAEVKKLLQNEIHLRKAAEEEVDYLKNRL--GQFTQP 522

Query: 80 EINQGQELMMLSRRLED 30
E E++ L + LED
Sbjct: 523 EAGGNSEILKLRKSLED 539


>tr|A3B870|A3B870_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019242 PE=3 SV=1
Length = 824

Score = 110 bits (276), Expect = 5e-23
Identities = 73/170 (42%), Positives = 97/170 (57%), Gaps = 1/170 (0%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSL RRL +EL++ E ERQ K
Sbjct: 309 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLCRRLDIELDKLIAENERQRK 368

Query: 437 LLLD-VXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRME 261
D + + +LE E+ +Y +E +++++ LE + Q+
Sbjct: 369 YFDDEIERITAEAQLRVTEAEREYKISLEN---EKAKYHQEYLDSIKILEEKWKIHQQSP 425

Query: 260 SELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKS 111
+L+ + + EV E++ L+NE LR AE E LK+
Sbjct: 426 KKLIKETE----------PTSSEVGEVQNLLQNEKVLRQSAEDEANDLKN 465


>tr|A2Y909|A2Y909_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21543 PE=3 SV=1
Length = 891

Score = 110 bits (276), Expect = 5e-23
Identities = 73/170 (42%), Positives = 97/170 (57%), Gaps = 1/170 (0%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSL RRL +EL++ E ERQ K
Sbjct: 376 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLCRRLDIELDKLIAENERQRK 435

Query: 437 LLLD-VXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQRME 261
D + + +LE E+ +Y +E +++++ LE + Q+
Sbjct: 436 YFDDEIERITAEAQLRVTEAEREYKISLEN---EKAKYHQEYLDSIKILEEKWKIHQQSP 492

Query: 260 SELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQAERELCTLKS 111
+L+ + + EV E++ L+NE LR AE E LK+
Sbjct: 493 KKLIKETE----------PTSSEVGEVQNLLQNEKVLRQSAEDEANDLKN 532


>tr|A5BIN7|A5BIN7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029907 PE=3 SV=1
Length = 960

Score = 102 bits (253), Expect = 2e-20
Identities = 58/118 (49%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPSPRHRGET STI+FGQRAMKVENM+K+KEEFDYKSL RRL ++L++ E ERQ K
Sbjct: 381 TIGPSPRHRGETASTILFGQRAMKVENMLKIKEEFDYKSLSRRLDIQLDKLIAENERQQK 440

Query: 437 LL-LDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNLESERIERQR 267
+V ALEK ER++ Q E +E+++ LE + + Q+
Sbjct: 441 AFEEEVERITLEAQKRVSEVERNYADALEK---ERLKCQMEYMESVKQLEEKLVTNQK 495


>tr|A7PI02|A7PI02_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018145001
PE=3 SV=1
Length = 995

Score = 99.0 bits (245), Expect = 2e-19
Identities = 64/163 (39%), Positives = 91/163 (55%), Gaps = 4/163 (2%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPS RH ETTSTIMFGQRAMK+ NMVKLKEEFDY+SL R+L ++++ T EIERQ K
Sbjct: 356 TIGPSARHHAETTSTIMFGQRAMKIVNMVKLKEEFDYESLCRKLEKQVDQLTEEIERQQK 415

Query: 437 LLLDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKEQVEALQNL--ESERIERQ-- 270
L ++ +++ + Q EA +NL SE +E++
Sbjct: 416 L---------------------RKNDTDELEKRLIECQNTFAEAEKNLVTRSEFLEKENT 454

Query: 269 RMESELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQ 141
R+E E+ + N D + DEV L++ L++ Q +L+
Sbjct: 455 RLELEMKDFLNELNHQKDLNVLMRDEVASLEMSLKHSKQYQLE 497


>tr|A3AE81|A3AE81_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009103 PE=3 SV=1
Length = 705

Score = 86.3 bits (212), Expect = 1e-15
Identities = 53/165 (32%), Positives = 87/165 (52%), Gaps = 6/165 (3%)
Frame = -3

Query: 617 TIGPSPRHRGETTSTIMFGQRAMKVENMVKLKEEFDYKSLYRRLGMELERRTTEIERQAK 438
TIGPS RH ET+STIMFGQRAMK+ N +++KEE DY+SLY+++ E++ T+E+ERQ K
Sbjct: 312 TIGPSSRHFSETSSTIMFGQRAMKIVNTIRIKEEVDYESLYKKVEHEVDHLTSEMERQQK 371

Query: 437 LLLDVXXXXXXXXXXXXXXXXXXESALEKMAAERVRYQKE------QVEALQNLESERIE 276
L EKM E+ + E +V + +E+ +E
Sbjct: 372 L-----------------------KNSEKMQLEKKLKESEASLNDLKVTSNMQIENMAME 408

Query: 275 RQRMESELLAAMQHHNDASDPCKQLTDEVLELKLQLENESQLRLQ 141
++++ES + M L+++++ L+ L+ Q +L+
Sbjct: 409 KRQLESTIKRLMLDLEKEKGKNNILSEQIIHLETSLDENKQKQLE 453