BP914094
Clone id YMU001_000039_G08
Library
Length 538
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000039_G08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACCTTGGACCAAAGCCACGTCACTCGCCAGCTTGCCTCTATGTTCTACGACAGACTTCA
TGGTGAAATAGTGACCCTCATGTCCCGTCACAGTTGAAGAAGTGCATTCCTTCTCATTCT
CATTACTTCCGGATTCTGCTTCTCTTAAATCAATATTCAAAAGTTCATTTTCAATAACCT
CATATTCACCCGTCTCTGCCGCTAATACCTCTGCCCTCAGGATTTCAAATATATCCACAT
ACTCAATTGAGAGCTGTGTTGCAAGCCCACAGTACTCTCCCTTCAGGACACTTAGTGATG
AGTCCTCCATATCTGTGGTCTTGGATACCAAACCTGCGTCTACCGTTACAGCATTGCCCA
CCTCACATTTTTGAGATTCCTCTATACAGTTAGCATCTGGACATCTCAATTCTCGACCAC
ACAACTCAGTATCTTCCACAACATGCGAAGGGTCGCAATTGGGTGCAATACATAAAACTG
ACTGGTCCACAAGCTCCATGGCGTCCACCTATTCACAACCCAGATGTTGCATTTGCAC
■■Homology search results ■■ -
sp_hit_id O13854
Definition sp|O13854|ADG2_SCHPO Serine/threonine-rich protein adg2 OS=Schizosaccharomyces pombe
Align length 152
Score (bit) 35.0
E-value 0.23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914094|Adiantum capillus-veneris mRNA, clone:
YMU001_000039_G08.
(538 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O13854|ADG2_SCHPO Serine/threonine-rich protein adg2 OS=Schiz... 35 0.23
sp|Q4L9P0|SRAP_STAHJ Serine-rich adhesin for platelets OS=Staphy... 35 0.30
sp|Q8VQ99|SRAP_STAAU Serine-rich adhesin for platelets OS=Staphy... 32 2.5
sp|B0C7T1|CHLN_ACAM1 Light-independent protochlorophyllide reduc... 32 2.6
sp|Q924H7|WAC_MOUSE WW domain-containing adapter protein with co... 31 3.3
sp|Q53479|IDSA_METTM Bifunctional short chain isoprenyl diphosph... 31 3.4
sp|Q6NUB7|ZRN1B_XENLA Ubiquitin thioesterase zranb1-B OS=Xenopus... 31 4.4
sp|Q5U595|ZRN1A_XENLA Ubiquitin thioesterase zranb1-A OS=Xenopus... 31 4.4
sp|B1H2Q2|ZRAN1_XENTR Ubiquitin thioesterase zranb1 OS=Xenopus t... 31 4.4
sp|Q96DN2|VWCE_HUMAN von Willebrand factor C and EGF domain-cont... 31 4.4
sp|Q7A362|SRAP_STAAN Serine-rich adhesin for platelets OS=Staphy... 30 5.7
sp|Q99QY4|SRAP_STAAM Serine-rich adhesin for platelets OS=Staphy... 30 5.7
sp|P57680|EVC_MOUSE Ellis-van Creveld syndrome protein homolog O... 30 5.7
sp|Q7M760|ZRAN1_MOUSE Ubiquitin thioesterase Zranb1 OS=Mus muscu... 30 5.7
sp|Q9UGI0|ZRAN1_HUMAN Ubiquitin thioesterase ZRANB1 OS=Homo sapi... 30 5.7
sp|A0JMQ9|ZRAN1_DANRE Ubiquitin thioesterase zranb1 OS=Danio rer... 30 5.7
sp|A6QP16|ZRAN1_BOVIN Ubiquitin thioesterase ZRANB1 OS=Bos tauru... 30 5.7
sp|P61618|Y1652_METMP Uncharacterized solute-binding protein MMP... 30 5.7
sp|Q8JZY4|MRRP3_MOUSE Mitochondrial ribonuclease P protein 3 OS=... 30 5.7
sp|Q82HM9|GUAA_STRAW GMP synthase [glutamine-hydrolyzing] OS=Str... 30 5.7
sp|Q8NUJ3|SRAP_STAAW Serine-rich adhesin for platelets OS=Staphy... 30 7.4
sp|Q6G620|SRAP_STAAS Serine-rich adhesin for platelets OS=Staphy... 30 7.4
sp|Q5HCP3|SRAP_STAAC Serine-rich adhesin for platelets OS=Staphy... 30 7.4
sp|Q2FUW1|SRAP_STAA8 Serine-rich adhesin for platelets OS=Staphy... 30 7.4
sp|Q2FDK5|SRAP_STAA3 Serine-rich adhesin for platelets OS=Staphy... 30 7.4
sp|P68390|IOVO_MELGA Ovomucoid OS=Meleagris gallopavo PE=1 SV=1 30 7.4
sp|A4T0N1|MNME_POLSQ tRNA modification GTPase mnmE OS=Polynucleo... 30 7.5
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE... 30 9.7
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces ... 30 9.7
sp|A2ARV4|LRP2_MOUSE Low-density lipoprotein receptor-related pr... 30 9.8

>sp|O13854|ADG2_SCHPO Serine/threonine-rich protein adg2
OS=Schizosaccharomyces pombe GN=adg2 PE=2 SV=3
Length = 670

Score = 35.0 bits (79), Expect = 0.23
Identities = 35/152 (23%), Positives = 59/152 (38%), Gaps = 5/152 (3%)
Frame = +3

Query: 15 ATSLASLPLCSTTDFMVK**PSCPVTVEEVHSFSFSLLPDXXXXXXXXXXXXXXXXXXPV 194
AT+ +S P S + +V P+ T V SFS S P
Sbjct: 502 ATATSSSPYYSNSSIIV---PTTVSTSGSVSSFSSSPSPTSSFSGTSALSSSSNEETTTT 558

Query: 195 SAANTSALRISNISTYSIESCVASPQ-----YSPFRTLSDESSISVVLDTKPASTVTALP 359
+ + +T + +C + P+ S T+S+ S S + + S+ ++
Sbjct: 559 TQVTYTTSPEETTTTMTTTTCSSRPEETISTVSTTSTVSESGSSSASITSTYPSSTLSMT 618

Query: 360 TSHF*DSSIQLASGHLNSRPHNSVSSTTCEGS 455
TSH SS+ +S H +S +S+S GS
Sbjct: 619 TSHLSSSSVHSSSAHSSSSRSSSMSLPPSAGS 650


>sp|Q4L9P0|SRAP_STAHJ Serine-rich adhesin for platelets
OS=Staphylococcus haemolyticus (strain JCSC1435) GN=sraP
PE=3 SV=1
Length = 3608

Score = 34.7 bits (78), Expect = 0.30
Identities = 34/105 (32%), Positives = 48/105 (45%), Gaps = 1/105 (0%)
Frame = +3

Query: 198 AANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISV-VLDTKPASTVTALPTSHF* 374
+ +TS +++ST S S S + SD +S S V D+ AST + TS
Sbjct: 1364 STSTSVSDSTSVSTSLSASTSTSESDSTSTSTSDSASTSTSVSDSTSASTSLSASTSTSV 1423

Query: 375 DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
S AS L++ SVS +T + L A T S S+ AST
Sbjct: 1424 SDSTS-ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 1467



Score = 33.5 bits (75), Expect = 0.67
Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 3/109 (2%)
Frame = +3

Query: 192 VSAANTSALRISNISTYSIE---SCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPT 362
VSA+ ++++ S ++ S+ S S S +LS+ +S SV D+ AST + T
Sbjct: 1505 VSASTSTSVSDSTSASTSLSGSTSTSVSDSTSTSTSLSESTSTSVS-DSASASTSLSAST 1563

Query: 363 SHF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
S S AS L++ SVS +T + L A T S S+ AST
Sbjct: 1564 STSVSDSTS-ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 1611



Score = 32.3 bits (72), Expect = 1.5
Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 3/109 (2%)
Frame = +3

Query: 192 VSAANTSALRISNISTYSIESCVA---SPQYSPFRTLSDESSISVVLDTKPASTVTALPT 362
+SA+ ++++ S ++ S+ + + S S +LS +S SV T +++++A +
Sbjct: 1955 LSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTS 2014

Query: 363 SHF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
+ DS+ AS L++ SVS +T + L A T S S+ AST
Sbjct: 2015 TSVSDSTS--ASTSLSASTSTSVSDSTSTSTSLSASTSTSVSDSTSAST 2061



Score = 32.3 bits (72), Expect = 1.5
Identities = 34/105 (32%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
Frame = +3

Query: 198 AANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISV-VLDTKPASTVTALPTSHF* 374
+ +TS ++ ST S S S + SD +S S V D+ AST + TS
Sbjct: 2678 STSTSVSDSTSASTSLSGSTSTSVSDSTSTSTSDSASTSTSVSDSTSASTSLSASTSTSV 2737

Query: 375 DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
S AS L++ SVS +T + L A T S S+ AST
Sbjct: 2738 SDSTS-ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 2781



Score = 32.0 bits (71), Expect = 1.9
Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 1/106 (0%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISV-VLDTKPASTVTALPTSHF 371
+A + SA ++ ST + +S S S + S +S S V D+ AST + TS
Sbjct: 565 TANSQSASTSTSTSTANSQSTSTSTSTSTANSQSTSTSTSTSVSDSTSASTSLSGSTSTS 624

Query: 372 *DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
S AS L+ SVS +T + L A T S S+ AST
Sbjct: 625 VSDSTS-ASTSLSDSASTSVSDSTSASTSLSASTSTSESDSTSAST 669



Score = 32.0 bits (71), Expect = 1.9
Identities = 30/108 (27%), Positives = 55/108 (50%), Gaps = 3/108 (2%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVA---SPQYSPFRTLSDESSISVVLDTKPASTVTALPTS 365
SA+ ++++ S ++ S+ + + S S +LS +S SV T +++++A ++
Sbjct: 1920 SASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTST 1979

Query: 366 HF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
DS+ AS L++ SVS +T + L A T S S+ AST
Sbjct: 1980 SVSDSTS--ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 2025



Score = 32.0 bits (71), Expect = 1.9
Identities = 30/108 (27%), Positives = 55/108 (50%), Gaps = 3/108 (2%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVA---SPQYSPFRTLSDESSISVVLDTKPASTVTALPTS 365
SA+ ++++ S ++ S+ + + S S +LS +S SV T +++++A ++
Sbjct: 2712 SASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTST 2771

Query: 366 HF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
DS+ AS L++ SVS +T + L A T S S+ AST
Sbjct: 2772 SVSDSTS--ASTSLSASTSTSVSDSTSTNTSLSASTSTSVSDSTSAST 2817



Score = 32.0 bits (71), Expect = 1.9
Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 3/109 (2%)
Frame = +3

Query: 192 VSAANTSALRISNISTYSIESCVA---SPQYSPFRTLSDESSISVVLDTKPASTVTALPT 362
+SA+ ++++ S ++ S+ + + S S +LS +S SV T +++++A +
Sbjct: 2765 LSASTSTSVSDSTSASTSLSASTSTSVSDSTSTNTSLSASTSTSVSDSTSASTSLSASTS 2824

Query: 363 SHF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
+ DS+ AS L++ SVS +T + L A T S S+ AST
Sbjct: 2825 TSVSDSTS--ASTSLSASTSTSVSDSTSTSTSLSASTSTSVSDSTSAST 2871



Score = 31.2 bits (69), Expect = 3.3
Identities = 32/105 (30%), Positives = 47/105 (44%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTSHF* 374
++A+TS ++ S S S S ++SD +S S L AST T++ S
Sbjct: 1553 ASASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLS---ASTSTSVSDS--- 1606

Query: 375 DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
AS L++ SVS +T + L A T S S+ AST
Sbjct: 1607 ----TSASTSLSASTSTSVSDSTSTSTSLSASTSTSVSDSTSAST 1647



Score = 31.2 bits (69), Expect = 3.3
Identities = 33/107 (30%), Positives = 46/107 (42%), Gaps = 3/107 (2%)
Frame = +3

Query: 198 AANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISV---VLDTKPASTVTALPTSH 368
+ +TS + ST + +S S S + S S S V D+ AST + TS
Sbjct: 1902 SGSTSTSVSDSTSTSTSDSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTST 1961

Query: 369 F*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
S AS L++ SVS +T + L A T S S+ AST
Sbjct: 1962 SVSDSTS-ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 2007



Score = 30.4 bits (67), Expect = 5.7
Identities = 34/105 (32%), Positives = 46/105 (43%), Gaps = 1/105 (0%)
Frame = +3

Query: 198 AANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISV-VLDTKPASTVTALPTSHF* 374
+ +TS + ST S S S + SD +S S V D+ AST + TS
Sbjct: 1886 STSTSVSDSISRSTSLSGSTSTSVSDSTSTSTSDSASTSTSVSDSTSASTSLSASTSTSV 1945

Query: 375 DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
S AS L++ SVS +T + L A T S S+ AST
Sbjct: 1946 SDSTS-ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 1989



Score = 30.4 bits (67), Expect = 5.7
Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 3/109 (2%)
Frame = +3

Query: 192 VSAANTSALRISNISTYSIESCVA---SPQYSPFRTLSDESSISVVLDTKPASTVTALPT 362
+SA+ ++++ S ++ S+ + + S S +LS +S SV T +++++A +
Sbjct: 2729 LSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTS 2788

Query: 363 SHF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
+ DS+ S L++ SVS +T + L A T S S+ AST
Sbjct: 2789 TSVSDSTSTNTS--LSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 2835



Score = 30.4 bits (67), Expect = 5.7
Identities = 30/104 (28%), Positives = 45/104 (43%)
Frame = +3

Query: 198 AANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTSHF*D 377
+A+TS ++ S S S S +LSD +S S L +++V+ D
Sbjct: 2940 SASTSVSASTSTSVSDSTSTSTSLSESTSTSLSDSASASTSLSDSASTSVS--------D 2991

Query: 378 SSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
S+ AS L+ SVS +T + L T S S+ AST
Sbjct: 2992 STS--ASTSLSESTSTSVSDSTSTSTSLSGSESTSLSDSASAST 3033



Score = 30.0 bits (66), Expect = 7.4
Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 3/108 (2%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVA---SPQYSPFRTLSDESSISVVLDTKPASTVTALPTS 365
SA+ ++++ S ++ S+ + + S S +LS +S SV T +++++A ++
Sbjct: 1398 SASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSASTSLSASTST 1457

Query: 366 HF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
DS+ AS L++ SVS +T + L T S S AST
Sbjct: 1458 SVSDSTS--ASTSLSASTSTSVSDSTSMSTSLSGSESTSLSDSLSAST 1503



Score = 30.0 bits (66), Expect = 7.4
Identities = 33/114 (28%), Positives = 48/114 (42%), Gaps = 9/114 (7%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVL---------DTKPASTV 347
++A+TS ++ S S S S ++SD +S+S L D+ AST
Sbjct: 1445 TSASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSMSTSLSGSESTSLSDSLSASTS 1504

Query: 348 TALPTSHF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
+ TS S AS L+ SVS +T + L T S S+ AST
Sbjct: 1505 VSASTSTSVSDSTS-ASTSLSGSTSTSVSDSTSTSTSLSESTSTSVSDSASAST 1557



Score = 30.0 bits (66), Expect = 7.4
Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
Frame = +3

Query: 198 AANTSALRISNISTYSI----ESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTS 365
+A+TS + ST + S S S +LS +S SV T +++ +A ++
Sbjct: 1866 SASTSTSESDSTSTSTSLSGSTSTSVSDSISRSTSLSGSTSTSVSDSTSTSTSDSASTST 1925

Query: 366 HF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
DS+ AS L++ SVS +T + L A T S S+ AST
Sbjct: 1926 SVSDSTS--ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 1971



Score = 30.0 bits (66), Expect = 7.4
Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
Frame = +3

Query: 198 AANTSALRISNISTYSI----ESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTS 365
+A+TS + ST + S S S +LS +S SV T +++ +A ++
Sbjct: 2334 SASTSTSESDSTSTSTSLSGSTSTSVSDSISGSTSLSGSTSTSVSDSTSTSTSDSASTST 2393

Query: 366 HF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
DS+ AS L++ SVS +T + L A T S S+ AST
Sbjct: 2394 SVSDSTS--ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 2439



Score = 30.0 bits (66), Expect = 7.4
Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 8/113 (7%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTV---TALPTS 365
++ +TS ++ S + S S S ++SD +S S L +++V T+ TS
Sbjct: 2471 TSTSTSLSESTSTSLSNSASASTSLSGSTSTSVSDSTSASTSLSASTSTSVSDSTSTSTS 2530

Query: 366 HF*DSSIQL-----ASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
+S L AS L+ SVS +T + L T S S+ AST
Sbjct: 2531 LSESTSTSLSDSASASTSLSDSASTSVSDSTSASTSLSGSESTSLSDSASAST 2583



Score = 30.0 bits (66), Expect = 7.4
Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
Frame = +3

Query: 198 AANTSALRISNISTYSI----ESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTS 365
+A+TS + ST + S S S +LS +S SV T +++ +A ++
Sbjct: 2658 SASTSTSESDSTSTSTSLSGSTSTSVSDSTSASTSLSGSTSTSVSDSTSTSTSDSASTST 2717

Query: 366 HF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
DS+ AS L++ SVS +T + L A T S S+ AST
Sbjct: 2718 SVSDSTS--ASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 2763



Score = 30.0 bits (66), Expect = 7.4
Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 8/113 (7%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTV---TALPTS 365
++A+TS ++ S S S S ++SD +S S L +++V T+ TS
Sbjct: 2813 TSASTSLSASTSTSVSDSTSASTSLSASTSTSVSDSTSTSTSLSASTSTSVSDSTSASTS 2872

Query: 366 HF*DSSIQL-----ASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
+S L AS +++ SVS +T + L T S S+ AST
Sbjct: 2873 LSGSASASLSDSLSASTSVSASTSTSVSDSTSTSTSLSESTSTSLSNSASAST 2925



Score = 30.0 bits (66), Expect = 7.4
Identities = 32/93 (34%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
Frame = +3

Query: 234 STYSIESCVASPQYSPFRTLSDESSISV-VLDTKPASTVTALPTSHF*DSSIQLASGHLN 410
ST S S S + SD +S S V D+ AST + TS S AS L+
Sbjct: 3140 STSLSGSTSTSVSDSTSTSTSDSASTSTSVSDSTSASTSLSASTSTSVSDSTS-ASTSLS 3198

Query: 411 SRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
+ SVS +T + L A T S S+ AST
Sbjct: 3199 ASTSTSVSDSTSASTSLSASTSTSVSDSTSAST 3231



Score = 29.6 bits (65), Expect = 9.7
Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 2/107 (1%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTSHF* 374
++A+TS ++ S S S S +LSD +SIS L AST T+ S
Sbjct: 1823 TSASTSLSGSTSTSVSDSTSTSTSLSESTSTSLSDSTSISTSLS---ASTSTSESDSTST 1879

Query: 375 DSSIQLASGHLNSRPHNSVS-STTCEGSQLGAI-HKTDWSTSSMAST 509
+S+ SG ++ +S+S ST+ GS ++ T STS AST
Sbjct: 1880 STSL---SGSTSTSVSDSISRSTSLSGSTSTSVSDSTSTSTSDSAST 1923



Score = 29.6 bits (65), Expect = 9.7
Identities = 33/114 (28%), Positives = 48/114 (42%), Gaps = 9/114 (7%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVL---------DTKPASTV 347
++A+TS ++ S S S S ++SD +S+S L D+ AST
Sbjct: 2111 ASASTSLSGSTSTSVSDSTSASTSLSASTSTSVSDSTSMSTSLSGSESTSLSDSLSASTS 2170

Query: 348 TALPTSHF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
+ TS S AS L+ SVS +T + L T S S+ AST
Sbjct: 2171 VSASTSTSVSDSTS-ASTSLSGSTSTSVSDSTSTSTSLSESTSTSVSDSASAST 2223


>sp|Q8VQ99|SRAP_STAAU Serine-rich adhesin for platelets
OS=Staphylococcus aureus GN=sraP PE=3 SV=1
Length = 2283

Score = 31.6 bits (70), Expect = 2.5
Identities = 27/105 (25%), Positives = 46/105 (43%)
Frame = +3

Query: 192 VSAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTSHF 371
+S A + + S + SI + +A+ Q S + SD S S+ L T + +++ +
Sbjct: 919 ISTAESLSESASTSDSISISNSIANSQ-SASTSKSDSQSTSISLSTSDSKSMSTSESLSD 977

Query: 372 *DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAS 506
S+ SG L+ SVS++T + I STS S
Sbjct: 978 STSTSDSVSGSLSVAGSQSVSTSTSDSMSTSEIVSDSISTSGSLS 1022


>sp|B0C7T1|CHLN_ACAM1 Light-independent protochlorophyllide
reductase subunit N OS=Acaryochloris marina (strain MBIC
11017) GN=chlN PE=3 SV=1
Length = 470

Score = 31.6 bits (70), Expect = 2.6
Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 9/74 (12%)
Frame = -1

Query: 436 EDTELCGRELRCPDANCI-EESQKCEVGNAVT--VDAG-----LVSKTTDMEDSSLSVLK 281
EDT L RCP + + EES+K E GNA+T ++ G +V++ ++ D + V+
Sbjct: 149 EDTVLAAMAHRCPKGSAVVEESEKQERGNAITSLLNFGKKKEEVVAEESEYHDHAPLVMF 208

Query: 280 GEYCG-LATQLSIE 242
G + TQL++E
Sbjct: 209 GSLPDPVVTQLTLE 222


>sp|Q924H7|WAC_MOUSE WW domain-containing adapter protein with
coiled-coil OS=Mus musculus GN=Wac PE=1 SV=2
Length = 646

Score = 31.2 bits (69), Expect = 3.3
Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 4/80 (5%)
Frame = +3

Query: 264 SPQYSPFRTLSDESSISVVL----DTKPASTVTALPTSHF*DSSIQLASGHLNSRPHNSV 431
SP P T S +S + V+ +PA ++T +HF D+ I+ G
Sbjct: 523 SPSPGPNHTCSSNASTATVVPQNASARPACSLTPTLAAHFNDNLIKHVQGWPADHAEKQA 582

Query: 432 SSTTCEGSQLGAIHKTDWST 491
S E +G++H ++ T
Sbjct: 583 SRLREEAHNMGSVHMSEICT 602


>sp|Q53479|IDSA_METTM Bifunctional short chain isoprenyl diphosphate
synthase OS=Methanobacterium thermoautotrophicum (strain
Marburg / DSM 2133) GN=idsA PE=1 SV=3
Length = 325

Score = 31.2 bits (69), Expect = 3.4
Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
Frame = -1

Query: 280 GEYCGLATQLSIEYVDIFEILRAEVLAAETGEYEVIENELLNIDLREAESGSNENEKECT 101
G++ GLA Q+ +Y+D+ + E L G ++ E ++ + ++ E S E+ +
Sbjct: 203 GKFIGLAFQIHDDYLDV--VSDEESLGKPVGS-DIAEGKMTLMVVKALEEASEEDRERLI 259

Query: 100 SSTVTGHEGHYFTMKSVVEHRG--KLASDVAL 11
S +G EG + E G + A +VAL
Sbjct: 260 SILGSGDEGSVAEAIEIFERYGATQYAHEVAL 291


>sp|Q6NUB7|ZRN1B_XENLA Ubiquitin thioesterase zranb1-B OS=Xenopus
laevis GN=zranb1-B PE=2 SV=1
Length = 701

Score = 30.8 bits (68), Expect = 4.4
Identities = 10/23 (43%), Positives = 13/23 (56%)
Frame = -2

Query: 531 CNIWVVNRWTPWSLWTSQFYVLH 463
C+ W +RW W W SQ + LH
Sbjct: 466 CSHWFYSRWKEWESWYSQSFGLH 488


>sp|Q5U595|ZRN1A_XENLA Ubiquitin thioesterase zranb1-A OS=Xenopus
laevis GN=zranb1-A PE=2 SV=1
Length = 701

Score = 30.8 bits (68), Expect = 4.4
Identities = 10/23 (43%), Positives = 13/23 (56%)
Frame = -2

Query: 531 CNIWVVNRWTPWSLWTSQFYVLH 463
C+ W +RW W W SQ + LH
Sbjct: 466 CSHWFYSRWKEWESWYSQSFGLH 488


>sp|B1H2Q2|ZRAN1_XENTR Ubiquitin thioesterase zranb1 OS=Xenopus
tropicalis GN=zranb1 PE=2 SV=1
Length = 701

Score = 30.8 bits (68), Expect = 4.4
Identities = 10/23 (43%), Positives = 13/23 (56%)
Frame = -2

Query: 531 CNIWVVNRWTPWSLWTSQFYVLH 463
C+ W +RW W W SQ + LH
Sbjct: 466 CSHWFYSRWKEWESWYSQSFGLH 488


>sp|Q96DN2|VWCE_HUMAN von Willebrand factor C and EGF
domain-containing protein OS=Homo sapiens GN=VWCE PE=2
SV=1
Length = 955

Score = 30.8 bits (68), Expect = 4.4
Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 20/100 (20%)
Frame = -1

Query: 481 SVLCIAPNCDPSHVVEDTELC----------GRELRCPDANCIEESQKCEVGNAVTVDAG 332
S +CIAPN E C G +L C C E ++ C VG ++T +A
Sbjct: 77 SGICIAPNVCSCQDGEQGATCPETHGPCGEYGCDLTCNHGGCQEVARVCPVGFSMT-EAA 135

Query: 331 LVSKTTDMEDSSLSVLKGE----------YCGLATQLSIE 242
+ + TD+++ S +G CG QLS +
Sbjct: 136 VGIRCTDIDECVTSSCEGHCVNTEGGFVCECGPGMQLSAD 175


tr_hit_id B6GZR8
Definition tr|B6GZR8|B6GZR8_PENCH Pc12g09690 protein OS=Penicillium chrysogenum Wisconsin 54-1255
Align length 115
Score (bit) 38.5
E-value 0.22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914094|Adiantum capillus-veneris mRNA, clone:
YMU001_000039_G08.
(538 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6GZR8|B6GZR8_PENCH Pc12g09690 protein OS=Penicillium chrysog... 39 0.22
tr|B4KDQ9|B4KDQ9_DROMO GI23064 OS=Drosophila mojavensis GN=GI230... 38 0.38
tr|B6ILI5|B6ILI5_CAEBR Putative uncharacterized protein OS=Caeno... 37 0.65
tr|O94317|O94317_SCHPO Sequence orphan OS=Schizosaccharomyces po... 37 0.85
tr|B4KYE3|B4KYE3_DROMO GI12833 OS=Drosophila mojavensis GN=GI128... 36 1.1
tr|B4K9N1|B4K9N1_DROMO GI24300 OS=Drosophila mojavensis GN=GI243... 36 1.1
tr|B6LPF6|B6LPF6_BRAFL Putative uncharacterized protein OS=Branc... 36 1.5
tr|B5DLH0|B5DLH0_DROPS GA22626 OS=Drosophila pseudoobscura pseud... 35 1.9
tr|Q3MP25|Q3MP25_CANAL Putative uncharacterized protein CaJ7.038... 35 1.9
tr|Q87IY6|Q87IY6_VIBPA Putative multidrug efflux system transmem... 35 1.9
tr|Q1V803|Q1V803_VIBAL Putative multidrug efflux system transmem... 35 1.9
tr|A7K2B5|A7K2B5_9VIBR Membrane-fusion protein OS=Vibrio sp. Ex2... 35 1.9
tr|A6B5T0|A6B5T0_VIBPA Acriflavin resistance periplasmic protein... 35 1.9
tr|B1QUJ2|B1QUJ2_CLOBU Putative uncharacterized protein OS=Clost... 35 2.5
tr|B4JLH1|B4JLH1_DROGR GH11869 OS=Drosophila grimshawi GN=GH1186... 35 2.5
tr|A9UXC9|A9UXC9_MONBE Predicted protein OS=Monosiga brevicollis... 35 2.5
tr|A8MC82|A8MC82_CALMQ Putative uncharacterized protein OS=Caldi... 35 2.5
tr|B4N3R7|B4N3R7_DROWI GK25518 OS=Drosophila willistoni GN=GK255... 35 3.2
tr|A0NJS0|A0NJS0_OENOE Gamma-D-glutamate-meso-diaminopimelate mu... 34 4.2
tr|Q6CBR5|Q6CBR5_YARLI YALI0C16247p OS=Yarrowia lipolytica GN=YA... 34 4.2
tr|A3LMX6|A3LMX6_PICST Hypothetical cell wall protein OS=Pichia ... 34 4.2
tr|A2QUZ5|A2QUZ5_ASPNC Contig An10c0020, complete genome. OS=Asp... 34 4.2
tr|Q6LRK5|Q6LRK5_PHOPR Putative uncharacterized protein OS=Photo... 34 4.3
tr|Q26882|Q26882_TOXCA Surface coat glycoprotein TES-120 OS=Toxo... 34 5.5
tr|B7AQJ2|B7AQJ2_9BACE Putative uncharacterized protein OS=Bacte... 34 5.6
tr|Q6BLM2|Q6BLM2_DEBHA DEHA2F12320p OS=Debaryomyces hansenii GN=... 34 5.6
tr|B2RXP9|B2RXP9_MOUSE D6Ertd527e protein OS=Mus musculus GN=D6E... 33 7.2
tr|Q6BMP1|Q6BMP1_DEBHA DEHA2F03762p OS=Debaryomyces hansenii GN=... 33 7.2
tr|B6Y038|B6Y038_ANATH Putative uncharacterized protein OS=Anaer... 33 7.3
tr|A6QW95|A6QW95_AJECN Predicted protein OS=Ajellomyces capsulat... 33 7.3

>tr|B6GZR8|B6GZR8_PENCH Pc12g09690 protein OS=Penicillium
chrysogenum Wisconsin 54-1255 GN=Pc12g09690 PE=3 SV=1
Length = 407

Score = 38.5 bits (88), Expect = 0.22
Identities = 34/115 (29%), Positives = 52/115 (45%), Gaps = 13/115 (11%)
Frame = +3

Query: 204 NTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTVTA---------- 353
++S ++T S S ++SP S F T + S IS +S++TA
Sbjct: 256 SSSVSSTPTLATSSSVSAISSPSTSSFITETSSSIISTSATPMTSSSITASSISPTTSTH 315

Query: 354 LPTSHF*D---SSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
LPTS F SS S H+++ P + +S T S A H + ST++ ST
Sbjct: 316 LPTSTFTSNTISSTMSPSTHISTTPELTSASMTSSTSLSTATHLSTTSTTTRKST 370


>tr|B4KDQ9|B4KDQ9_DROMO GI23064 OS=Drosophila mojavensis GN=GI23064
PE=4 SV=1
Length = 1751

Score = 37.7 bits (86), Expect = 0.38
Identities = 30/109 (27%), Positives = 52/109 (47%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTSHF* 374
+A T+ + +IST ++S A+ + T++ +++ V ++ +T TA TS
Sbjct: 51 AAMPTTLMPPLDIST-EVDSTTATTTTTTTTTVAAATTVGVEQSSESIATATATSTSTML 109

Query: 375 DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMASTYSQP 521
DSS L + LN+ +SST+ S T STS T ++P
Sbjct: 110 DSSTTLGANKLNASEAVDISSTSSSSSSTAQDETTLRSTSIEPITSTEP 158


>tr|B6ILI5|B6ILI5_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG25396 PE=4 SV=1
Length = 201

Score = 37.0 bits (84), Expect = 0.65
Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSD-ESSISVVLDTKPAST-VTALPTSH 368
S+ +TS + ++ S ES ++S S T+S+ S S++L T S+ TAL TS
Sbjct: 59 SSESTSTSALPTSASASSESMLSSTTGSSSSTISELPDSTSIILSTSSTSSPTTALTTSE 118

Query: 369 F*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSS 497
DS L+S ++VSSTT S T STSS
Sbjct: 119 SPDSRSTLSSTSTTGPSESTVSSTTSTVSS-----STSESTSS 156


>tr|O94317|O94317_SCHPO Sequence orphan OS=Schizosaccharomyces pombe
GN=SPBC215.13 PE=2 SV=1
Length = 534

Score = 36.6 bits (83), Expect = 0.85
Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 7/114 (6%)
Frame = +3

Query: 195 SAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTV-------TA 353
S++++S L S++ST SI S +S S +LS SS S + +S++ ++
Sbjct: 223 SSSSSSTLTSSSLSTSSIPS-TSSSSSSTSSSLSSSSSSSTASSSSSSSSIISSSSSSSS 281

Query: 354 LPTSHF*DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMASTYS 515
PTS +S ++S +S S SST S + + S+SSM+S+ S
Sbjct: 282 SPTS----TSSTISSSSSSSSSPTSTSSTISSSSSSSSSFSSTLSSSSMSSSSS 331


>tr|B4KYE3|B4KYE3_DROMO GI12833 OS=Drosophila mojavensis GN=GI12833
PE=4 SV=1
Length = 911

Score = 36.2 bits (82), Expect = 1.1
Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 15/101 (14%)
Frame = +3

Query: 249 ESCVASPQYSPFRTLSDE-------SSISVVLDTKPASTVTALPTSHF*DSSIQLASGHL 407
+ C+AS SP +L DE +IS V+DT+P LP+S + + A+
Sbjct: 710 QQCIASSTTSPVLSLLDEMVEVGPAETISGVIDTRPLEARGTLPSSST-TNIVATAANTS 768

Query: 408 NSRPHN-------SVSSTTCEGSQLGAI-HKTDWSTSSMAS 506
NS N S SS+ C GSQ A H T T++ ++
Sbjct: 769 NSSSSNSSNSNSSSSSSSNCSGSQDAATSHYTQLCTTTTSA 809


>tr|B4K9N1|B4K9N1_DROMO GI24300 OS=Drosophila mojavensis GN=GI24300
PE=4 SV=1
Length = 556

Score = 36.2 bits (82), Expect = 1.1
Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 2/76 (2%)
Frame = -1

Query: 490 VDQSVLCIAPN--CDPSHVVEDTELCGRELRCPDANCIEESQKCEVGNAVTVDAGLVSKT 317
+D+ CI C + ED E CG LRC D +EE KC G++ + K
Sbjct: 160 IDEKGNCIPMERKCREGSIEEDPEDCGGYLRCVDGRLVEE--KCAKGSSFNAEL----KI 213

Query: 316 TDMEDSSLSVLKGEYC 269
++++ + + K E C
Sbjct: 214 CQIDENGICIPKSERC 229


>tr|B6LPF6|B6LPF6_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_72981 PE=4 SV=1
Length = 353

Score = 35.8 bits (81), Expect = 1.5
Identities = 37/156 (23%), Positives = 66/156 (42%), Gaps = 18/156 (11%)
Frame = -1

Query: 499 MELVDQSVLCIAP-----NCDPSHVVEDTELCGRELRCP-DANCIEESQKCEVGNAVTVD 338
M+ V++ +C P +C+P E + G P N ++S + +V A T
Sbjct: 1 MQTVNEKTICAVPRLNNADCEP----EPADCVGTHAEVPLTMNSDQDSNQTDVAGAETPI 56

Query: 337 AGLVSKTTDMEDSSLSVLKGEYCGLATQLSIEYVDIFEILRAEVLAAETG---------- 188
+ L TTD + S+++ + E +A + S I+E + +G
Sbjct: 57 SNLYEDTTDHKASAMNAEQREGEDVAQESSTSVSSIYEDTAKKAAEQMSGIYVCGDSGVS 116

Query: 187 --EYEVIENELLNIDLREAESGSNENEKECTSSTVT 86
YE E + D +E+ESG + ++ S+TVT
Sbjct: 117 SRLYENSEKTNKSTDGKESESGMYQTDRR-ASATVT 151


>tr|B5DLH0|B5DLH0_DROPS GA22626 OS=Drosophila pseudoobscura
pseudoobscura GN=GA22626 PE=4 SV=1
Length = 390

Score = 35.4 bits (80), Expect = 1.9
Identities = 18/46 (39%), Positives = 24/46 (52%)
Frame = +3

Query: 375 DSSIQLASGHLNSRPHNSVSSTTCEGSQLGAIHKTDWSTSSMASTY 512
D+S+ LA+GHL RPHN V C S + A+ S +TY
Sbjct: 74 DASMVLANGHLLERPHNEVGIIACSRSIVYALRMLAHSIDEPLTTY 119


>tr|Q3MP25|Q3MP25_CANAL Putative uncharacterized protein CaJ7.0381
OS=Candida albicans GN=CaJ7.0381 PE=4 SV=1
Length = 1562

Score = 35.4 bits (80), Expect = 1.9
Identities = 27/108 (25%), Positives = 53/108 (49%), Gaps = 2/108 (1%)
Frame = +3

Query: 192 VSAANTSALRISNISTYSIESCVASPQYSPFRTLSDESSISVVLDTKPASTVTALPTSHF 371
VS+++ + S+ S+ + S F + SD+ S S+ + S+V++ PTS
Sbjct: 597 VSSSDNGSSSASSPSSSQSSIASTAESSSTFPSSSDQQSSSIQSPSSQESSVSSTPTSSL 656

Query: 372 *DSSIQLASGHLNS--RPHNSVSSTTCEGSQLGAIHKTDWSTSSMAST 509
S+ ++S +S P S +S+T S L + +D S S+ +++
Sbjct: 657 QSSTNTISSSQDSSSFSPTTSDNSSTNSASSLSTLSSSDTSVSNPSTS 704


>tr|Q87IY6|Q87IY6_VIBPA Putative multidrug efflux system
transmembrane protein OS=Vibrio parahaemolyticus
GN=VPA0470 PE=4 SV=1
Length = 380

Score = 35.4 bits (80), Expect = 1.9
Identities = 20/95 (21%), Positives = 42/95 (44%)
Frame = -1

Query: 361 VGNAVTVDAGLVSKTTDMEDSSLSVLKGEYCGLATQLSIEYVDIFEILRAEVLAAETGEY 182
VGN + ++ G + ++ + +++ GEY L +L + +D I A V + G+Y
Sbjct: 260 VGNKIDLETGSIRAEAQFDNPTYALMPGEYGNLTIKLRNKTIDGLLIPSAAVQQDQAGDY 319

Query: 181 EVIENELLNIDLREAESGSNENEKECTSSTVTGHE 77
++ + + R E G K + + +E
Sbjct: 320 VMVVGDDHVVSRRNVELGQTYGVKRAVLTGLAANE 354