BP914110
Clone id YMU001_000042_A03
Library
Length 431
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000042_A03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAGGTACTCTTTTTGGAACAAAAGTTGGACTGAATAATGTGGAAGCAAAAGCTCTTTTGT
CATGGCATGGCAGTATGTAACACAGTGTGTAGAAGCCATCATGGGGCATACACACACATG
AATGCTGTCATGGCCATCTATTGTCAGGAGAACGTACACATGAATTCGACATAGCTGCGA
CATAGCTATTATGGCAGTATGCATGAGCTCCTTATGGGGAATAGCAAAATTGTACACATG
AATGCGCATAACCATTACGGGGAATGCACTCACATCAATGCCACATAACCATCACAAGGA
GTTGAATGCTGTCACAGCAAACTACTCTCAGGATCAATTTATGTTTCTTGAAGAGAAAAA
GCTGCTTGTGGAGTATGGTATAGAAAAGGAGGAGGCTGAGTCATTAACATGGTAGGCAAA
ACTGGCTGCCT
■■Homology search results ■■ -
sp_hit_id Q587J7
Definition sp|Q587J7|TDR12_HUMAN Tudor domain-containing protein 12 OS=Homo sapiens
Align length 110
Score (bit) 33.1
E-value 0.49
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914110|Adiantum capillus-veneris mRNA, clone:
YMU001_000042_A03.
(431 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q587J7|TDR12_HUMAN Tudor domain-containing protein 12 OS=Homo... 33 0.49
sp|Q8IZF7|GP111_HUMAN Probable G-protein coupled receptor 111 OS... 30 3.2
sp|P56185|RNJ_HELPY Ribonuclease J OS=Helicobacter pylori GN=HP_... 30 5.5
sp|Q9D2H5|TRI42_MOUSE Tripartite motif-containing protein 42 OS=... 29 9.3
sp|Q5BIP2|PGFRL_BOVIN Platelet-derived growth factor receptor-li... 29 9.3

>sp|Q587J7|TDR12_HUMAN Tudor domain-containing protein 12 OS=Homo
sapiens GN=TDRD12 PE=2 SV=2
Length = 1177

Score = 33.1 bits (74), Expect = 0.49
Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 10/110 (9%)
Frame = +2

Query: 104 GHTHT*MLSWPSIVRRTYT*IRHSCDIAIMAVCMSSLWGIAKLYT*MRITITGNALTSMP 283
G +HT SWP I R CD+ +++ C S+ + L + + TG S+P
Sbjct: 438 GPSHTESYSWPPIAR--------GCDVVVISHCESN--PLLYLLPVLTVLQTGACYKSLP 487

Query: 284 HNHHKELNAVTANYSQDQFMF--LEEKKL--------LVEYGIEKEEAES 403
+ V + + QF+F L E + L+ G+ KEEA++
Sbjct: 488 SRNGPLAVIVCPGWKKAQFIFELLGEYSMSSRPLHPVLLTIGLHKEEAKN 537


>sp|Q8IZF7|GP111_HUMAN Probable G-protein coupled receptor 111
OS=Homo sapiens GN=GPR111 PE=2 SV=1
Length = 708

Score = 30.4 bits (67), Expect = 3.2
Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 4/91 (4%)
Frame = +2

Query: 122 MLSWPSIVRRTYT*IRHSCDIAIMA-VCMSSLWGIAKLYT*MRITITGNALTSMPHNHHK 298
+L W + + T +RH C + I A + M+ +W I + S P HHK
Sbjct: 469 VLVWSQVTKTEITYLRHVCIVNIAATLLMADVWFIVA------------SFLSGPITHHK 516

Query: 299 ELNAVT---ANYSQDQFMFLEEKKLLVEYGI 382
A T + F ++ K LL+ YGI
Sbjct: 517 GCVAATFFVHFFYLSVFFWMLAKALLILYGI 547


>sp|P56185|RNJ_HELPY Ribonuclease J OS=Helicobacter pylori
GN=HP_1430 PE=3 SV=1
Length = 689

Score = 29.6 bits (65), Expect = 5.5
Identities = 10/19 (52%), Positives = 16/19 (84%)
Frame = +2

Query: 281 PHNHHKELNAVTANYSQDQ 337
P+NHHK+ +A T NY+Q++
Sbjct: 67 PNNHHKQKHAKTRNYAQEE 85


>sp|Q9D2H5|TRI42_MOUSE Tripartite motif-containing protein 42 OS=Mus
musculus GN=Trim42 PE=2 SV=1
Length = 723

Score = 28.9 bits (63), Expect = 9.3
Identities = 8/23 (34%), Positives = 15/23 (65%)
Frame = -3

Query: 129 DSIHVCVCPMMASTHCVTYCHAM 61
++ + +CPM + +HC+ Y H M
Sbjct: 181 ENFFILICPMCSRSHCMPYSHQM 203


>sp|Q5BIP2|PGFRL_BOVIN Platelet-derived growth factor receptor-like
protein OS=Bos taurus GN=PDGFRL PE=2 SV=1
Length = 375

Score = 28.9 bits (63), Expect = 9.3
Identities = 16/45 (35%), Positives = 23/45 (51%)
Frame = +1

Query: 247 HNHYGECTHINAT*PSQGVECCHSKLLSGSIYVS*REKAACGVWY 381
H YG+ T +N+T G C +L +G YV R++A G Y
Sbjct: 122 HERYGQLTLVNSTAADTGEFSCWGQLCTG--YVCRRDEAKTGSTY 164


tr_hit_id A2GEK8
Definition tr|A2GEK8|A2GEK8_TRIVA ABC transporter family protein OS=Trichomonas vaginalis G3
Align length 57
Score (bit) 37.4
E-value 0.38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914110|Adiantum capillus-veneris mRNA, clone:
YMU001_000042_A03.
(431 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2GEK8|A2GEK8_TRIVA ABC transporter family protein OS=Trichom... 37 0.38
tr|Q4H2N2|Q4H2N2_CIOIN Transcription factor protein (Fragment) O... 37 0.65
tr|Q8IL42|Q8IL42_PLAF7 Putative uncharacterized protein OS=Plasm... 36 0.84
tr|B4JKM2|B4JKM2_DROGR GH12695 OS=Drosophila grimshawi GN=GH1269... 36 0.84
tr|B4M1S6|B4M1S6_DROVI GJ18794 OS=Drosophila virilis GN=GJ18794 ... 33 7.1
tr|A9DQ43|A9DQ43_9FLAO GCN5-related N-acetyltransferase OS=Kordi... 33 9.3
tr|Q4DK23|Q4DK23_TRYCR Putative uncharacterized protein OS=Trypa... 33 9.3

>tr|A2GEK8|A2GEK8_TRIVA ABC transporter family protein
OS=Trichomonas vaginalis G3 GN=TVAG_542460 PE=3 SV=1
Length = 697

Score = 37.4 bits (85), Expect = 0.38
Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
Frame = +2

Query: 245 RITITGNALTSM-PHNHHKELNAVTANYSQDQFMFLEEKKLLVEYGIEKEEAESLTW 412
RITI G+ + + PH H+++ V SQD +F E K+ V YG+EK + + W
Sbjct: 430 RITIDGHDIKDLDPHWLHRKMALV----SQDPILFQETVKMNVMYGVEKNKTDEEVW 482


>tr|Q4H2N2|Q4H2N2_CIOIN Transcription factor protein (Fragment)
OS=Ciona intestinalis GN=Ci-Unc4-B PE=2 SV=1
Length = 228

Score = 36.6 bits (83), Expect = 0.65
Identities = 16/26 (61%), Positives = 20/26 (76%)
Frame = -1

Query: 428 QPVLPTMLMTQPPPFLYHTPQAAFSL 351
QP++P+ +MT PPP LYH P A FSL
Sbjct: 5 QPLVPSSMMTYPPP-LYHRPSARFSL 29


>tr|Q8IL42|Q8IL42_PLAF7 Putative uncharacterized protein
OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0407 PE=4
SV=1
Length = 3384

Score = 36.2 bits (82), Expect = 0.84
Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 2/66 (3%)
Frame = +1

Query: 88 CRSHHGAYTHMN--AVMAIYCQENVHMNST*LRHSYYGSMHELLMGNSKIVHMNAHNHYG 261
C SHH ++H N +C N H + H Y + H +++ H N H+H+
Sbjct: 581 CHSHHNYHSHHNYHCHHNYHCHHNYHNHHNYHCHHNYHNHHNEHNNHNEHNHNNEHSHHN 640

Query: 262 ECTHIN 279
E H N
Sbjct: 641 EHNHHN 646


>tr|B4JKM2|B4JKM2_DROGR GH12695 OS=Drosophila grimshawi GN=GH12695
PE=4 SV=1
Length = 1658

Score = 36.2 bits (82), Expect = 0.84
Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 6/54 (11%)
Frame = -2

Query: 202 AYCHNSYVA---AMSNSCVRSPDNRWP*QHSCVCMPHDGFYT---LCYILPCHD 59
AYCH+S A N+C+ +R+ Q+ C+ DGFY LPCHD
Sbjct: 1106 AYCHSSCATCNGATENNCITCRPSRYAWQNKCLNNCPDGFYADKKRLECLPCHD 1159


>tr|B4M1S6|B4M1S6_DROVI GJ18794 OS=Drosophila virilis GN=GJ18794 PE=4
SV=1
Length = 1657

Score = 33.1 bits (74), Expect = 7.1
Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 6/53 (11%)
Frame = -2

Query: 199 YCHNSYVA---AMSNSCVRSPDNRWP*QHSCVCMPHDGFYT---LCYILPCHD 59
YCH+S A N+C+ +R+ Q+ C+ DGFY LPCH+
Sbjct: 1104 YCHSSCATCNGATENNCITCRPSRYAWQNKCLNNCPDGFYADKKRLECLPCHE 1156


>tr|A9DQ43|A9DQ43_9FLAO GCN5-related N-acetyltransferase OS=Kordia
algicida OT-1 GN=KAOT1_15433 PE=4 SV=1
Length = 177

Score = 32.7 bits (73), Expect = 9.3
Identities = 22/64 (34%), Positives = 29/64 (45%)
Frame = +2

Query: 197 VCMSSLWGIAKLYT*MRITITGNALTSMPHNHHKELNAVTANYSQDQFMFLEEKKLLVEY 376
VC+ W + KL T IT GN + HK L + NY +D F + E +L Y
Sbjct: 119 VCLKYAWNVMKLNTVYGITEKGNEAS------HKVLLKIGLNYIED-FFYKPENMMLRWY 171

Query: 377 GIEK 388
I K
Sbjct: 172 SISK 175


>tr|Q4DK23|Q4DK23_TRYCR Putative uncharacterized protein
OS=Trypanosoma cruzi GN=Tc00.1047053506525.120 PE=4 SV=1
Length = 755

Score = 32.7 bits (73), Expect = 9.3
Identities = 24/84 (28%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
Frame = -2

Query: 256 NGYAHSCVQFCYSP*GAHAYCHNSYVAAMSNSCVRSPDNRWP*QHSCVCMPHDGFYTLCY 77
N + +C + C P G N VAA++ S + P Q + +P D + L
Sbjct: 224 NSNSGNCQEACAEPCGLWEESGNITVAALAPSATPQRIQQQPKQEAHAFLPKDESF-LTI 282

Query: 76 ILPCHDKRAF--ASTLFSPTFVPK 11
L CH + + + FSP F PK
Sbjct: 283 ELQCHQQSPYEPSEKSFSPPFYPK 306