BP914132
Clone id YMU001_000042_C03
Library
Length 487
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000042_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTTTTTTTTTTTTGATAGAAGTATTGTGATTTTTATACACTAACAAGGATTTAA
ATTACAACAGAAGCATGTCTGATCCAAGAATGACTTCTTTATGACAAGAGAGTGCAACAC
AAGGAGCAACACCGCCATGCGTACTATTGCATAACACCATTGACCATGTACATTTCTTTG
CCATGCTCAAAGGGCAGCAGTAATTATACATACTTAAGAGACTACTTCGCTAGAAATTAT
TTGGCATTCAGGGGATGCTACCAGAGTACAGCCAAAAGACCAATACTCCAGGTCCTTCCC
CACAATTATAATCCCCACAAGCGGCAAGTCCCTATGCGCATCACCTCTTTGACTCCCCAT
GATTTTGTAAAGGGCGTTGCAGAATAGATATATACACCTGCATACAAAAGCCCTTCTCCT
CTATACACAACAAACTCATATTCATACCTGGAACGCGTTGCTAGACAATGCAAGCATCCA
TTCATAT
■■Homology search results ■■ -
sp_hit_id P50901
Definition sp|P50901|HOX3_BRAFL Homeobox protein HOX3 OS=Branchiostoma floridae
Align length 60
Score (bit) 33.1
E-value 0.62
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914132|Adiantum capillus-veneris mRNA, clone:
YMU001_000042_C03.
(468 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P50901|HOX3_BRAFL Homeobox protein HOX3 OS=Branchiostoma flor... 33 0.62
sp|Q87N95|Y1980_VIBPA UPF0313 protein VP1980 OS=Vibrio parahaemo... 31 2.3
sp|Q9KRD1|Y1711_VIBCH UPF0313 protein VC_1711 OS=Vibrio cholerae... 31 2.3
sp|Q9ZK38|DEOD_HELPJ Purine nucleoside phosphorylase deoD-type O... 31 2.3
sp|Q1CS88|DEOD_HELPH Purine nucleoside phosphorylase deoD-type O... 31 2.3
sp|Q894Z3|DEOD_CLOTE Purine nucleoside phosphorylase deoD-type O... 31 2.3
sp|P56463|DEOD_HELPY Purine nucleoside phosphorylase deoD-type O... 31 3.1
sp|Q9HUN6|Y4928_PSEAE UPF0313 protein PA4928 OS=Pseudomonas aeru... 30 5.2
sp|Q8DAI5|Y2212_VIBVU UPF0313 protein VV1_2212 OS=Vibrio vulnifi... 30 5.2
sp|Q7MJL8|Y2143_VIBVY UPF0313 protein VV2143 OS=Vibrio vulnificu... 30 5.2
sp|A0Q1A0|DEOD_CLONN Purine nucleoside phosphorylase deoD-type O... 30 5.2
sp|Q8CZS4|Y674_YERPE Putative UPF0313 protein YPO0674/y3502/YP_2... 30 6.8
sp|Q0W0L6|Y189_UNCMA UPF0313 protein UNCMA_01890 OS=Uncultured m... 30 6.8
sp|Q0HXQ1|DEOD_SHESR Purine nucleoside phosphorylase deoD-type O... 30 6.8
sp|Q0HLE7|DEOD_SHESM Purine nucleoside phosphorylase deoD-type O... 30 6.8
sp|Q12QG0|DEOD_SHEDO Purine nucleoside phosphorylase deoD-type O... 30 6.8
sp|A1S477|DEOD_SHEAM Purine nucleoside phosphorylase deoD-type O... 30 6.8
sp|Q483Q8|DEOD_COLP3 Purine nucleoside phosphorylase deoD-type O... 30 6.8
sp|A6M0X2|DEOD_CLOB8 Purine nucleoside phosphorylase deoD-type O... 30 6.8
sp|Q8EHK0|DEOD2_SHEON Purine nucleoside phosphorylase deoD-type ... 30 6.8
sp|Q87VK8|Y4928_PSESM UPF0313 protein PSPTO_4928 OS=Pseudomonas ... 29 8.9
sp|Q88DF3|Y4872_PSEPK UPF0313 protein PP_4872 OS=Pseudomonas put... 29 8.9
sp|A0P8Z4|NR6A1_PIG Nuclear receptor subfamily 6 group A member ... 29 8.9
sp|Q15406|NR6A1_HUMAN Nuclear receptor subfamily 6 group A membe... 29 8.9
sp|Q5KZM1|DEOD_GEOKA Purine nucleoside phosphorylase deoD-type O... 29 8.9
sp|Q7NRT2|DEOD_CHRVO Purine nucleoside phosphorylase deoD-type O... 29 8.9
sp|Q7MI41|DEOD1_VIBVY Purine nucleoside phosphorylase deoD-type ... 29 8.9
sp|Q8DBS9|DEOD1_VIBVU Purine nucleoside phosphorylase deoD-type ... 29 8.9

>sp|P50901|HOX3_BRAFL Homeobox protein HOX3 OS=Branchiostoma
floridae PE=2 SV=1
Length = 411

Score = 33.1 bits (74), Expect = 0.62
Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 5/60 (8%)
Frame = +3

Query: 237 CYQSTAKRPILQVLPH-----NYNPHKRQVPMRITSLTPHDFVKGVAE*IYTPAYKSPSP 401
CYQS PH N+ PH RQ P +T+ P ++ V++ YTP PSP
Sbjct: 292 CYQSNHSPCPPSSAPHPVPMGNHVPHPRQGPPHMTNGLPASPLEVVSQRQYTPPAPGPSP 351


>sp|Q87N95|Y1980_VIBPA UPF0313 protein VP1980 OS=Vibrio
parahaemolyticus GN=VP1980 PE=3 SV=1
Length = 777

Score = 31.2 bits (69), Expect = 2.3
Identities = 15/35 (42%), Positives = 21/35 (60%)
Frame = -2

Query: 326 GDAHRDLPLVGIIIVGKDLEYWSFGCTLVASPECQ 222
GDA+ D P G+ I+G+ LE F ++A PE Q
Sbjct: 47 GDAYVDHPSFGMAIIGRLLEAQGFRVGIIAQPEWQ 81


>sp|Q9KRD1|Y1711_VIBCH UPF0313 protein VC_1711 OS=Vibrio cholerae
GN=VC_1711 PE=3 SV=1
Length = 789

Score = 31.2 bits (69), Expect = 2.3
Identities = 15/35 (42%), Positives = 21/35 (60%)
Frame = -2

Query: 326 GDAHRDLPLVGIIIVGKDLEYWSFGCTLVASPECQ 222
GDA+ D P G+ I+G+ LE F ++A PE Q
Sbjct: 47 GDAYVDHPSFGMAIIGRLLEAQGFRVGIIAQPEWQ 81


>sp|Q9ZK38|DEOD_HELPJ Purine nucleoside phosphorylase deoD-type
OS=Helicobacter pylori J99 GN=deoD PE=3 SV=1
Length = 233

Score = 31.2 bits (69), Expect = 2.3
Identities = 17/47 (36%), Positives = 26/47 (55%)
Frame = -3

Query: 445 LATRSRYEYEFVVYRGEGLLYAGVYIYSATPFTKSWGVKEVMRIGTC 305
L +Y+ + + G G+ A IY T K++ VKE++RIGTC
Sbjct: 46 LGFSGKYKGKGISLMGHGMGIASCTIY-VTELIKTYQVKELLRIGTC 91


>sp|Q1CS88|DEOD_HELPH Purine nucleoside phosphorylase deoD-type
OS=Helicobacter pylori (strain HPAG1) GN=deoD PE=3 SV=1
Length = 233

Score = 31.2 bits (69), Expect = 2.3
Identities = 17/47 (36%), Positives = 26/47 (55%)
Frame = -3

Query: 445 LATRSRYEYEFVVYRGEGLLYAGVYIYSATPFTKSWGVKEVMRIGTC 305
L +Y+ + + G G+ A IY T K++ VKE++RIGTC
Sbjct: 46 LGFSGKYKGKGISLMGHGMGIASCTIY-VTELIKTYQVKELLRIGTC 91


>sp|Q894Z3|DEOD_CLOTE Purine nucleoside phosphorylase deoD-type
OS=Clostridium tetani GN=deoD PE=3 SV=1
Length = 235

Score = 31.2 bits (69), Expect = 2.3
Identities = 16/41 (39%), Positives = 26/41 (63%)
Frame = -3

Query: 427 YEYEFVVYRGEGLLYAGVYIYSATPFTKSWGVKEVMRIGTC 305
Y+ + V +G G+ + IY AT +S+GVK ++R+GTC
Sbjct: 52 YKGKRVSVQGTGMGIPSMSIY-ATELIESYGVKNLIRVGTC 91


>sp|P56463|DEOD_HELPY Purine nucleoside phosphorylase deoD-type
OS=Helicobacter pylori GN=deoD PE=3 SV=1
Length = 233

Score = 30.8 bits (68), Expect = 3.1
Identities = 17/47 (36%), Positives = 25/47 (53%)
Frame = -3

Query: 445 LATRSRYEYEFVVYRGEGLLYAGVYIYSATPFTKSWGVKEVMRIGTC 305
L +Y+ + G G+ A IY T K++ VKE++RIGTC
Sbjct: 46 LGFSGKYKGRGISLMGHGMGIASCTIY-VTELIKTYQVKELLRIGTC 91


>sp|Q9HUN6|Y4928_PSEAE UPF0313 protein PA4928 OS=Pseudomonas
aeruginosa GN=PA4928 PE=3 SV=1
Length = 747

Score = 30.0 bits (66), Expect = 5.2
Identities = 14/35 (40%), Positives = 21/35 (60%)
Frame = -2

Query: 326 GDAHRDLPLVGIIIVGKDLEYWSFGCTLVASPECQ 222
GDA+ D P G+ I+G+ LE F ++A P+ Q
Sbjct: 46 GDAYVDHPSFGMAIIGRLLEAQGFRVGIIAQPDWQ 80


>sp|Q8DAI5|Y2212_VIBVU UPF0313 protein VV1_2212 OS=Vibrio vulnificus
GN=VV1_2212 PE=3 SV=1
Length = 768

Score = 30.0 bits (66), Expect = 5.2
Identities = 14/35 (40%), Positives = 21/35 (60%)
Frame = -2

Query: 326 GDAHRDLPLVGIIIVGKDLEYWSFGCTLVASPECQ 222
GDA+ D P G+ I+G+ LE F ++A P+ Q
Sbjct: 47 GDAYVDHPSFGMAIIGRLLEAQGFRVGIIAQPQWQ 81


>sp|Q7MJL8|Y2143_VIBVY UPF0313 protein VV2143 OS=Vibrio vulnificus
(strain YJ016) GN=VV2143 PE=3 SV=1
Length = 768

Score = 30.0 bits (66), Expect = 5.2
Identities = 14/35 (40%), Positives = 21/35 (60%)
Frame = -2

Query: 326 GDAHRDLPLVGIIIVGKDLEYWSFGCTLVASPECQ 222
GDA+ D P G+ I+G+ LE F ++A P+ Q
Sbjct: 47 GDAYVDHPSFGMAIIGRLLEAQGFRVGIIAQPQWQ 81


tr_hit_id A6RF71
Definition tr|A6RF71|A6RF71_AJECN Putative uncharacterized protein OS=Ajellomyces capsulata (strain NAm1 / WU24)
Align length 29
Score (bit) 36.2
E-value 0.85
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914132|Adiantum capillus-veneris mRNA, clone:
YMU001_000042_C03.
(468 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6RF71|A6RF71_AJECN Putative uncharacterized protein OS=Ajell... 36 0.85
tr|B5W9D9|B5W9D9_SPIMA Glycosyl transferase group 1 OS=Arthrospi... 35 2.5
tr|Q1XD77|Q1XD77_PHARU NADH-ubiquinone oxidoreductase chain 6 OS... 33 7.2
tr|B6P362|B6P362_BRAFL Putative uncharacterized protein OS=Branc... 33 7.2

>tr|A6RF71|A6RF71_AJECN Putative uncharacterized protein
OS=Ajellomyces capsulata (strain NAm1 / WU24)
GN=HCAG_08287 PE=4 SV=1
Length = 987

Score = 36.2 bits (82), Expect = 0.85
Identities = 14/29 (48%), Positives = 18/29 (62%)
Frame = +2

Query: 230 QGMLPEYSQKTNTPGPSPQL*SPQAASPY 316
QG+LP Y+ TN PGP P P+ A P+
Sbjct: 730 QGVLPTYNDSTNAPGPGPGRSGPETADPH 758


>tr|B5W9D9|B5W9D9_SPIMA Glycosyl transferase group 1 OS=Arthrospira
maxima CS-328 GN=AmaxDRAFT_5389 PE=4 SV=1
Length = 557

Score = 34.7 bits (78), Expect = 2.5
Identities = 15/47 (31%), Positives = 25/47 (53%)
Frame = +3

Query: 198 RDYFARNYLAFRGCYQSTAKRPILQVLPHNYNPHKRQVPMRITSLTP 338
R+Y NYL++RGC+ L V +NP+ P ++T ++P
Sbjct: 309 REYADHNYLSYRGCHGVQTSTKPLGVFLQQFNPNIAVFPNQLTEVSP 355


>tr|Q1XD77|Q1XD77_PHARU NADH-ubiquinone oxidoreductase chain 6
OS=Phaethon rubricauda GN=ND6 PE=3 SV=1
Length = 173

Score = 33.1 bits (74), Expect = 7.2
Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
Frame = -3

Query: 415 FVVYRGEGLLYAGVY--IYSATPFTKSWGVKEVMRIGTCRLWGL*LWG 278
F+VY G G+L VY +A PF ++WG ++VM G C L L + G
Sbjct: 56 FMVYLG-GMLVVFVYSVALAADPFPEAWGDRQVMGYGVCLLLTLAVGG 102


>tr|B6P362|B6P362_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_102176 PE=4 SV=1
Length = 507

Score = 33.1 bits (74), Expect = 7.2
Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 5/60 (8%)
Frame = +3

Query: 237 CYQSTAKRPILQVLPH-----NYNPHKRQVPMRITSLTPHDFVKGVAE*IYTPAYKSPSP 401
CYQS PH N+ PH RQ P +T+ P ++ V++ YTP PSP
Sbjct: 388 CYQSNHSPCPPSSAPHPVPMGNHVPHPRQGPPHMTNGLPASPLEVVSQRQYTPPAPGPSP 447