BP914163
Clone id YMU001_000042_F08
Library
Length 252
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000042_F08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTTTAGGGTCACATGATTCAACTTAACACCACTATCAAGCATTTTACCCATCAG
TTCAAGGGCCTCCTGGCCGCATCCATGTTTTGCATATGCCACAAGCATGGCTGTCCATGA
CACCACGTCATGATCAATAATGCTATCAAAAGCATGACGTGCATCAGTTAAATGCCCACA
TTTAGAGTAAAAATCCACCAGAGTGCTTACCATGAACGCGTCGAGCTCAAGCCCACTCTG
AACTACATACAC
■■Homology search results ■■ -
sp_hit_id Q9FWA6
Definition sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein At3g02330 OS=Arabidopsis thaliana
Align length 78
Score (bit) 80.1
E-value 3.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914163|Adiantum capillus-veneris mRNA, clone:
YMU001_000042_F08.
(242 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protei... 80 3e-15
sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protei... 77 3e-14
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 76 6e-14
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 74 2e-13
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 74 2e-13
sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protei... 74 3e-13
sp|Q9LU94|PP255_ARATH Putative pentatricopeptide repeat-containi... 73 5e-13
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 73 5e-13
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 72 1e-12
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 72 1e-12
sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protei... 72 1e-12
sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protei... 71 2e-12
sp|Q9FXA9|PPR83_ARATH Putative pentatricopeptide repeat-containi... 70 3e-12
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 70 3e-12
sp|Q9SR01|PP212_ARATH Pentatricopeptide repeat-containing protei... 70 4e-12
sp|Q9FK33|PP427_ARATH Pentatricopeptide repeat-containing protei... 69 6e-12
sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containi... 69 6e-12
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 69 6e-12
sp|Q1PFQ9|PPR62_ARATH Pentatricopeptide repeat-containing protei... 69 1e-11
sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protei... 69 1e-11
sp|Q9ZQ74|PP146_ARATH Pentatricopeptide repeat-containing protei... 68 1e-11
sp|Q9XE98|PP303_ARATH Pentatricopeptide repeat-containing protei... 68 2e-11
sp|P0C8Q2|PP323_ARATH Pentatricopeptide repeat-containing protei... 67 2e-11
sp|Q38959|PP257_ARATH Pentatricopeptide repeat-containing protei... 67 2e-11
sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|O49399|PP321_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|Q9LUS3|PP237_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11

>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein
At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2
Length = 903

Score = 80.1 bits (196), Expect = 3e-15
Identities = 36/78 (46%), Positives = 52/78 (66%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
V++ L+ D ++ STLVD YSKCG L D+R F+ + D V+W AM+ YA HG G+EA
Sbjct: 629 VIKKELQSDVYICSTLVDMYSKCGDLHDSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEA 688

Query: 56 LELMGKMLDSGVKLNHVT 3
++L +M+ +K NHVT
Sbjct: 689 IQLFERMILENIKPNHVT 706



Score = 55.1 bits (131), Expect = 1e-07
Identities = 27/77 (35%), Positives = 42/77 (54%)
Frame = -1

Query: 233 VQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEAL 54
++S L LD + + +D Y KC L +A FD + D VSW A++ A+ ++G G E L
Sbjct: 409 IKSSLSLDVCVANAAIDMYGKCQALAEAFRVFDEMRRRDAVSWNAIIAAHEQNGKGYETL 468

Query: 53 ELMGKMLDSGVKLNHVT 3
L ML S ++ + T
Sbjct: 469 FLFVSMLRSRIEPDEFT 485



Score = 43.1 bits (100), Expect = 4e-04
Identities = 20/79 (25%), Positives = 45/79 (56%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
+ ++S D + + +D Y+KC ++ DA+ FD+ + + S+ AM+ Y++ G +
Sbjct: 306 HALKSDFAADGIVRTATLDMYAKCDNMQDAQILFDNSENLNRQSYNAMITGYSQEEHGFK 365

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL L +++ SG+ + ++
Sbjct: 366 ALLLFHRLMSSGLGFDEIS 384



Score = 35.4 bits (80), Expect = 0.089
Identities = 18/67 (26%), Positives = 35/67 (52%)
Frame = -1

Query: 212 DAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELMGKML 33
D + +++ YSK + A F+ + DVVSW +ML Y ++G +++E+ M
Sbjct: 113 DVVSWNKMINGYSKSNDMFKANSFFNMMPVRDVVSWNSMLSGYLQNGESLKSIEVFVDMG 172

Query: 32 DSGVKLN 12
G++ +
Sbjct: 173 REGIEFD 179



Score = 35.4 bits (80), Expect = 0.089
Identities = 18/67 (26%), Positives = 33/67 (49%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
VV+ G + D S L+D Y+K ++ F I + + VSW+A++ ++ A
Sbjct: 206 VVRVGCDTDVVAASALLDMYAKGKRFVESLRVFQGIPEKNSVSWSAIIAGCVQNNLLSLA 265

Query: 56 LELMGKM 36
L+ +M
Sbjct: 266 LKFFKEM 272



Score = 34.3 bits (77), Expect = 0.20
Identities = 16/54 (29%), Positives = 27/54 (50%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAK 78
+++ SG F+++ L+ Y+ A FD + DVVSW M+ Y+K
Sbjct: 73 HMIISGFRPTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNKMINGYSK 126



Score = 32.7 bits (73), Expect = 0.58
Identities = 19/92 (20%), Positives = 39/92 (42%), Gaps = 20/92 (21%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSI--------------------IDHD 117
+V+SG+ ++ + +L+D YSKCG + +A +
Sbjct: 508 IVKSGMASNSSVGCSLIDMYSKCGMIEEAEKIHSRFFQRANVSGTMEELEKMHNKRLQEM 567

Query: 116 VVSWTAMLVAYAKHGCGQEALELMGKMLDSGV 21
VSW +++ Y ++A L +M++ G+
Sbjct: 568 CVSWNSIISGYVMKEQSEDAQMLFTRMMEMGI 599


>sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protein
At3g53360, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E86 PE=2 SV=1
Length = 768

Score = 78.6 bits (192), Expect = 9e-15
Identities = 36/79 (45%), Positives = 55/79 (69%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y +++GL + F+ + L+D Y+KCG L AR FDS+ + DVVSW+ ++V YA+ G G+E
Sbjct: 498 YSLKTGLAPEQFIKNGLIDMYAKCGSLGQARRIFDSMDNRDVVSWSTLIVGYAQSGFGEE 557

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL L +M +G++ NHVT
Sbjct: 558 ALILFKEMKSAGIEPNHVT 576



Score = 55.8 bits (133), Expect = 6e-08
Identities = 24/69 (34%), Positives = 44/69 (63%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
+++ S + D + + ++ Y KCG L DAR FD + + ++VS+T+++ Y+++G G E
Sbjct: 92 HILNSNCKYDTILNNHILSMYGKCGSLRDAREVFDFMPERNLVSYTSVITGYSQNGQGAE 151

Query: 59 ALELMGKML 33
A+ L KML
Sbjct: 152 AIRLYLKML 160



Score = 50.1 bits (118), Expect = 4e-06
Identities = 24/70 (34%), Positives = 36/70 (51%)
Frame = -1

Query: 233 VQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEAL 54
++S L +A +L D Y++CG L AR FD I D SW ++ A +G EA+
Sbjct: 297 IKSELAGNAIAGCSLCDMYARCGFLNSARRVFDQIERPDTASWNVIIAGLANNGYADEAV 356

Query: 53 ELMGKMLDSG 24
+ +M SG
Sbjct: 357 SVFSQMRSSG 366



Score = 37.4 bits (85), Expect = 0.023
Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDH-DVVSWTAMLVAYAKHGCGQ 63
Y+++ G D + ++L+ Y+ C L + F+ ++ D VSW +L A +H
Sbjct: 396 YIIKWGFLADLTVCNSLLTMYTFCSDLYCCFNLFEDFRNNADSVSWNTILTACLQHEQPV 455

Query: 62 EALELMGKMLDSGVKLNHVT 3
E L L ML S + +H+T
Sbjct: 456 EMLRLFKLMLVSECEPDHIT 475



Score = 36.2 bits (82), Expect = 0.052
Identities = 17/59 (28%), Positives = 33/59 (55%)
Frame = -1

Query: 197 STLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELMGKMLDSGV 21
+ L+ Y + ++DA F I D++SW++++ +++ G EAL + +ML GV
Sbjct: 207 NALIAMYVRFNQMSDASRVFYGIPMKDLISWSSIIAGFSQLGFEFEALSHLKEMLSFGV 265


>sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protein
At3g26782, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H34 PE=2 SV=1
Length = 659

Score = 76.6 bits (187), Expect = 3e-14
Identities = 35/78 (44%), Positives = 52/78 (66%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
V++ GLE D + ++++D Y KCG + AR AFD + + +V SWTAM+ Y HG +A
Sbjct: 313 VIRMGLEDDVIVGTSIIDMYCKCGRVETARKAFDRMKNKNVRSWTAMIAGYGMHGHAAKA 372

Query: 56 LELMGKMLDSGVKLNHVT 3
LEL M+DSGV+ N++T
Sbjct: 373 LELFPAMIDSGVRPNYIT 390



Score = 53.9 bits (128), Expect = 2e-07
Identities = 26/64 (40%), Positives = 37/64 (57%)
Frame = -1

Query: 224 GLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELM 45
G + D F+ S L+ YS CG L DAR FD I ++VSWT+M+ Y +G +A+ L
Sbjct: 106 GYQSDIFVSSALIVMYSTCGKLEDARKVFDEIPKRNIVSWTSMIRGYDLNGNALDAVSLF 165

Query: 44 GKML 33
+L
Sbjct: 166 KDLL 169



Score = 46.6 bits (109), Expect = 4e-05
Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGH--LTDARHAFDSIIDHDVVSWTAMLVAYAKHGCG 66
+V++ G + + +TL+D Y+K G + AR FD I+D D VS+ +++ YA+ G
Sbjct: 208 FVIKRGFDRGVSVGNTLLDAYAKGGEGGVAVARKIFDQIVDKDRVSYNSIMSVYAQSGMS 267

Query: 65 QEALELMGKMLDSGV 21
EA E+ +++ + V
Sbjct: 268 NEAFEVFRRLVKNKV 282


>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein
At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1
Length = 834

Score = 75.9 bits (185), Expect = 6e-14
Identities = 31/78 (39%), Positives = 54/78 (69%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
+++ GLE + ++ + L+D Y+KCG DA AFDS DVV W +++ +YA HG G++A
Sbjct: 581 LLKRGLECNPYITNALLDMYAKCGSPEDAHKAFDSAASRDVVCWNSVISSYANHGEGKKA 640

Query: 56 LELMGKMLDSGVKLNHVT 3
L+++ KM+ G++ N++T
Sbjct: 641 LQMLEKMMSEGIEPNYIT 658



Score = 59.3 bits (142), Expect = 6e-09
Identities = 25/74 (33%), Positives = 47/74 (63%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
++++ GLE+DA +++ L+D Y KCG + A F+ + + +++SWT +L Y ++ +E
Sbjct: 274 HILRYGLEMDASLMNVLIDSYVKCGRVIAAHKLFNGMPNKNIISWTTLLSGYKQNALHKE 333

Query: 59 ALELMGKMLDSGVK 18
A+EL M G+K
Sbjct: 334 AMELFTSMSKFGLK 347



Score = 52.0 bits (123), Expect = 9e-07
Identities = 26/75 (34%), Positives = 42/75 (56%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y +++ L D+++ ++L+D Y+KC LTDAR FD DVV + AM+ Y++ G E
Sbjct: 375 YTIKANLGNDSYVTNSLIDMYAKCDCLTDARKVFDIFAAADVVLFNAMIEGYSRLGTQWE 434

Query: 59 ALELMGKMLDSGVKL 15
E + D +L
Sbjct: 435 LHEALNIFRDMRFRL 449



Score = 51.6 bits (122), Expect = 1e-06
Identities = 23/73 (31%), Positives = 44/73 (60%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
++V+SG + D ++ + L+DFY K G++ AR FD++ + V+WT M+ K G
Sbjct: 173 FLVKSGFDRDVYVGTLLIDFYLKDGNIDYARLVFDALPEKSTVTWTTMISGCVKMGRSYV 232

Query: 59 ALELMGKMLDSGV 21
+L+L ++++ V
Sbjct: 233 SLQLFYQLMEDNV 245



Score = 50.1 bits (118), Expect = 4e-06
Identities = 25/59 (42%), Positives = 32/59 (54%)
Frame = -1

Query: 224 GLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALEL 48
GL LD F S L+D YS C L D+R FD + D+V W +M Y + +EAL L
Sbjct: 484 GLNLDIFAGSALIDVYSNCYCLKDSRLVFDEMKVKDLVIWNSMFAGYVQQSENEEALNL 542



Score = 49.3 bits (116), Expect = 6e-06
Identities = 21/61 (34%), Positives = 39/61 (63%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
++ GLELD ++ + L++ YS+ G + AR F+ + + ++VSW+ M+ A HG +E+
Sbjct: 70 IIVWGLELDTYLSNILINLYSRAGGMVYARKVFEKMPERNLVSWSTMVSACNHHGIYEES 129

Query: 56 L 54
L
Sbjct: 130 L 130


>sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protein
At5g55740, chloroplastic OS=Arabidopsis thaliana
GN=CRR21 PE=2 SV=1
Length = 830

Score = 73.9 bits (180), Expect = 2e-13
Identities = 36/79 (45%), Positives = 48/79 (60%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
YVV+SGLE F+ S+L D Y KCG L DA FD I D + V+W A++V Y ++G +E
Sbjct: 198 YVVKSGLEDCVFVASSLADMYGKCGVLDDASKVFDEIPDRNAVAWNALMVGYVQNGKNEE 257

Query: 59 ALELMGKMLDSGVKLNHVT 3
A+ L M GV+ VT
Sbjct: 258 AIRLFSDMRKQGVEPTRVT 276



Score = 68.2 bits (165), Expect = 1e-11
Identities = 31/79 (39%), Positives = 46/79 (58%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y ++ E D + ST++D Y+KCG + DA+ FDS ++ D++ W +L AYA+ G E
Sbjct: 400 YCIRHSFESDIVLASTVMDMYAKCGSIVDAKKVFDSTVEKDLILWNTLLAAYAESGLSGE 459

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL L M GV N +T
Sbjct: 460 ALRLFYGMQLEGVPPNVIT 478



Score = 47.8 bits (112), Expect = 2e-05
Identities = 23/77 (29%), Positives = 44/77 (57%)
Frame = -1

Query: 233 VQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEAL 54
+ +G+ELD + ++L++FY K G + A FD + + DVV+W ++ Y + G ++A+
Sbjct: 301 IVNGMELDNILGTSLLNFYCKVGLIEYAEMVFDRMFEKDVVTWNLIISGYVQQGLVEDAI 360

Query: 53 ELMGKMLDSGVKLNHVT 3
+ M +K + VT
Sbjct: 361 YMCQLMRLEKLKYDCVT 377



Score = 42.0 bits (97), Expect = 0.001
Identities = 22/65 (33%), Positives = 38/65 (58%)
Frame = -1

Query: 197 STLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELMGKMLDSGVK 18
++LVD Y+KCG + A F S + ++ AM+ AYA +G +EA+ L + G+K
Sbjct: 586 TSLVDMYAKCGDINKAEKVFGSKLYSELPLSNAMISAYALYGNLKEAIALYRSLEGVGLK 645

Query: 17 LNHVT 3
+++T
Sbjct: 646 PDNIT 650



Score = 36.6 bits (83), Expect = 0.040
Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
Frame = -1

Query: 167 GHLTDARHAF----DSIIDHDVVSWTAMLVAYAKHGCGQEALELMGKMLDSGVKLN 12
G + +A+ F S I +++SWT M+ ++GC +EA+ + KM +SG++ N
Sbjct: 490 GQVDEAKDMFLQMQSSGIIPNLISWTTMMNGMVQNGCSEEAILFLRKMQESGLRPN 545



Score = 31.2 bits (69), Expect = 1.7
Identities = 18/62 (29%), Positives = 32/62 (51%)
Frame = -1

Query: 206 FMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELMGKMLDS 27
++ + LV FY+KC L A F + +V SW A++ + G + AL +ML++
Sbjct: 108 YIETKLVIFYAKCDALEIAEVLFSKLRVRNVFSWAAIIGVKCRIGLCEGALMGFVEMLEN 167

Query: 26 GV 21
+
Sbjct: 168 EI 169


>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein
At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=2 SV=1
Length = 697

Score = 73.9 bits (180), Expect = 2e-13
Identities = 34/76 (44%), Positives = 52/76 (68%)
Frame = -1

Query: 230 QSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALE 51
QSG E D F+ ++L+D Y KCG + + F +++ D VSW AM++ +A++G G EALE
Sbjct: 420 QSGEEDDIFVGNSLIDMYVKCGCVEEGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALE 479

Query: 50 LMGKMLDSGVKLNHVT 3
L +ML+SG K +H+T
Sbjct: 480 LFREMLESGEKPDHIT 495



Score = 65.1 bits (157), Expect = 1e-10
Identities = 30/78 (38%), Positives = 50/78 (64%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
+ +S D ++ S LVD YSKCG++ DA+ FD + D +VVSW +++ + ++G EA
Sbjct: 178 IAKSPFLSDVYIGSALVDMYSKCGNVNDAQRVFDEMGDRNVVSWNSLITCFEQNGPAVEA 237

Query: 56 LELMGKMLDSGVKLNHVT 3
L++ ML+S V+ + VT
Sbjct: 238 LDVFQMMLESRVEPDEVT 255



Score = 49.7 bits (117), Expect = 5e-06
Identities = 23/67 (34%), Positives = 36/67 (53%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
V++SG + F+ + L+D YSKCG L D R FD + ++ +W +++ K G EA
Sbjct: 46 VIKSGFSNEIFIQNRLIDAYSKCGSLEDGRQVFDKMPQRNIYTWNSVVTGLTKLGFLDEA 105

Query: 56 LELMGKM 36
L M
Sbjct: 106 DSLFRSM 112



Score = 41.2 bits (95), Expect = 0.002
Identities = 21/67 (31%), Positives = 35/67 (52%)
Frame = -1

Query: 221 LELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELMG 42
L D + + VD Y+KC + +AR FDS+ +V++ T+M+ YA + A +
Sbjct: 285 LRNDIILSNAFVDMYAKCSRIKEARFIFDSMPIRNVIAETSMISGYAMAASTKAARLMFT 344

Query: 41 KMLDSGV 21
KM + V
Sbjct: 345 KMAERNV 351


>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein
At3g57430, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H81 PE=2 SV=2
Length = 890

Score = 73.6 bits (179), Expect = 3e-13
Identities = 34/79 (43%), Positives = 50/79 (63%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y +++ L D + S LVD Y+KCG L +R FD I +V++W +++AY HG GQE
Sbjct: 542 YAIKNNLATDVAVGSALVDMYAKCGCLQMSRKVFDQIPQKNVITWNVIIMAYGMHGNGQE 601

Query: 59 ALELMGKMLDSGVKLNHVT 3
A++L+ M+ GVK N VT
Sbjct: 602 AIDLLRMMMVQGVKPNEVT 620



Score = 52.0 bits (123), Expect = 9e-07
Identities = 25/68 (36%), Positives = 40/68 (58%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
+VV+ GL+ D F+ +TL+D YS+ G + A F + D D+V+W M+ Y ++
Sbjct: 430 FVVKRGLDRDRFVQNTLMDMYSRLGKIDIAMRIFGKMEDRDLVTWNTMITGYVFSEHHED 489

Query: 59 ALELMGKM 36
AL L+ KM
Sbjct: 490 ALLLLHKM 497



Score = 47.0 bits (110), Expect = 3e-05
Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
Frame = -1

Query: 239 YVVQSG-LELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQ 63
Y +++G L+ ++F+ S LVD Y C + R FD + D + W AM+ Y+++ +
Sbjct: 327 YALKNGSLDENSFVGSALVDMYCNCKQVLSGRRVFDGMFDRKIGLWNAMIAGYSQNEHDK 386

Query: 62 EALEL-MGKMLDSGVKLNHVT 3
EAL L +G +G+ N T
Sbjct: 387 EALLLFIGMEESAGLLANSTT 407



Score = 43.1 bits (100), Expect = 4e-04
Identities = 23/72 (31%), Positives = 41/72 (56%)
Frame = -1

Query: 218 ELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELMGK 39
EL++F+++TLV Y K G L ++ S D+V+W +L + ++ EALE + +
Sbjct: 233 ELNSFIINTLVAMYGKLGKLASSKVLLGSFGGRDLVTWNTVLSSLCQNEQLLEALEYLRE 292

Query: 38 MLDSGVKLNHVT 3
M+ GV+ + T
Sbjct: 293 MVLEGVEPDEFT 304



Score = 40.8 bits (94), Expect = 0.002
Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
Frame = -1

Query: 239 YVVQSGLELDAFMVS-TLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQ 63
+V + G +D+ V+ TLV+ Y KCG FD I + + VSW +++ + +
Sbjct: 122 HVYKFGYGVDSVTVANTLVNLYRKCGDFGAVYKVFDRISERNQVSWNSLISSLCSFEKWE 181

Query: 62 EALELMGKMLDSGVKLNHVT 3
ALE MLD V+ + T
Sbjct: 182 MALEAFRCMLDENVEPSSFT 201


>sp|Q9LU94|PP255_ARATH Putative pentatricopeptide repeat-containing
protein At3g25970 OS=Arabidopsis thaliana GN=PCMP-E46
PE=3 SV=2
Length = 701

Score = 72.8 bits (177), Expect = 5e-13
Identities = 34/77 (44%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
Frame = -1

Query: 230 QSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIID-HDVVSWTAMLVAYAKHGCGQEAL 54
+SG + F++S+L+ YSKCG + AR F I H V+W AM++ YA+HG GQ +L
Sbjct: 436 KSGFVSNEFVISSLIVMYSKCGIIESARKCFQQISSKHSTVAWNAMILGYAQHGLGQVSL 495

Query: 53 ELMGKMLDSGVKLNHVT 3
+L +M + VKL+HVT
Sbjct: 496 DLFSQMCNQNVKLDHVT 512



Score = 47.0 bits (110), Expect = 3e-05
Identities = 23/67 (34%), Positives = 39/67 (58%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
V++ G E + ++ S+LVD Y+KC + DA AF I + + VSW A++ + + + A
Sbjct: 127 VIKGGYECNVYVGSSLVDMYAKCERVEDAFEAFKEISEPNSVSWNALIAGFVQVRDIKTA 186

Query: 56 LELMGKM 36
L+G M
Sbjct: 187 FWLLGLM 193



Score = 47.0 bits (110), Expect = 3e-05
Identities = 20/68 (29%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSI-IDHDVVSWTAMLVAYAKHGCGQE 60
V++ GL+ + + + ++ Y+ CG ++DA+ FD + D++SW +M+ ++KH +
Sbjct: 229 VLKLGLQHEITICNAMISSYADCGSVSDAKRVFDGLGGSKDLISWNSMIAGFSKHELKES 288

Query: 59 ALELMGKM 36
A EL +M
Sbjct: 289 AFELFIQM 296



Score = 42.0 bits (97), Expect = 0.001
Identities = 19/77 (24%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSK--CGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQ 63
V++ GLE + L+ Y + G + DA F+S+ D++SW +++ +A+ G +
Sbjct: 331 VIKKGLEQVTSATNALISMYIQFPTGTMEDALSLFESLKSKDLISWNSIITGFAQKGLSE 390

Query: 62 EALELMGKMLDSGVKLN 12
+A++ + S +K++
Sbjct: 391 DAVKFFSYLRSSEIKVD 407



Score = 38.5 bits (88), Expect = 0.011
Identities = 23/72 (31%), Positives = 34/72 (47%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y ++ G D ++ + ++D Y K G L A FD + D VSW M+ Y G ++
Sbjct: 25 YAIKCGSISDIYVSNRILDSYIKFGFLGYANMLFDEMPKRDSVSWNTMISGYTSCGKLED 84

Query: 59 ALELMGKMLDSG 24
A L M SG
Sbjct: 85 AWCLFTCMKRSG 96


>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein
At3g24000, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H87 PE=2 SV=1
Length = 633

Score = 72.8 bits (177), Expect = 5e-13
Identities = 34/79 (43%), Positives = 53/79 (67%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y+++SG +L AF +TL+D Y+K G + DAR FD + DVVSW ++L AYA+HG G+E
Sbjct: 287 YMIKSGEKLVAFAGNTLLDMYAKSGSIHDARKIFDRLAKRDVVSWNSLLTAYAQHGFGKE 346

Query: 59 ALELMGKMLDSGVKLNHVT 3
A+ +M G++ N ++
Sbjct: 347 AVWWFEEMRRVGIRPNEIS 365



Score = 55.8 bits (133), Expect = 6e-08
Identities = 27/79 (34%), Positives = 44/79 (55%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
+++QS D M +TL++ Y+KCG L +AR F+ + D V+WT ++ Y++H +
Sbjct: 85 HILQSIFRHDIVMGNTLLNMYAKCGSLEEARKVFEKMPQRDFVTWTTLISGYSQHDRPCD 144

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL +ML G N T
Sbjct: 145 ALLFFNQMLRFGYSPNEFT 163



Score = 51.2 bits (121), Expect = 2e-06
Identities = 24/77 (31%), Positives = 45/77 (58%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
+ V+ G + + + S L+D Y++ G + DA+ FD++ + VSW A++ +A+ ++
Sbjct: 186 FCVKCGFDSNVHVGSALLDLYTRYGLMDDAQLVFDALESRNDVSWNALIAGHARRSGTEK 245

Query: 59 ALELMGKMLDSGVKLNH 9
ALEL ML G + +H
Sbjct: 246 ALELFQGMLRDGFRPSH 262


>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing
protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32
PE=3 SV=1
Length = 715

Score = 71.6 bits (174), Expect = 1e-12
Identities = 36/78 (46%), Positives = 49/78 (62%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
YV++ G + F+ S LVD YSKCG++ AR FD + D VSWTA+++ +A HG G E
Sbjct: 368 YVLRGGFGSNIFIASALVDMYSKCGNIKAARKIFDRMNVLDEVSWTAIIMGHALHGHGHE 427

Query: 59 ALELMGKMLDSGVKLNHV 6
A+ L +M GVK N V
Sbjct: 428 AVSLFEEMKRQGVKPNQV 445



Score = 56.6 bits (135), Expect = 4e-08
Identities = 24/74 (32%), Positives = 44/74 (59%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
YV++ G++ D ++ S+LVD Y+K + D+ F + D +SW +++ Y ++G E
Sbjct: 267 YVIRKGIDSDVYIGSSLVDMYAKSARIEDSERVFSRLYCRDGISWNSLVAGYVQNGRYNE 326

Query: 59 ALELMGKMLDSGVK 18
AL L +M+ + VK
Sbjct: 327 ALRLFRQMVTAKVK 340



Score = 29.3 bits (64), Expect = 6.4
Identities = 14/53 (26%), Positives = 29/53 (54%)
Frame = -1

Query: 161 LTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELMGKMLDSGVKLNHVT 3
+ R F+ + DVVS+ ++ YA+ G ++AL ++ +M + +K + T
Sbjct: 192 IDSVRRVFEVMPRKDVVSYNTIIAGYAQSGMYEDALRMVREMGTTDLKPDSFT 244


tr_hit_id A9P0W0
Definition tr|A9P0W0|A9P0W0_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 78
Score (bit) 81.3
E-value 2.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914163|Adiantum capillus-veneris mRNA, clone:
YMU001_000042_F08.
(242 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9P0W0|A9P0W0_PICSI Putative uncharacterized protein OS=Picea... 81 2e-14
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 79 9e-14
tr|A5BS92|A5BS92_VITVI Putative uncharacterized protein OS=Vitis... 79 9e-14
tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genom... 78 2e-13
tr|A7QPS9|A7QPS9_VITVI Chromosome chr10 scaffold_138, whole geno... 78 2e-13
tr|A7PLK6|A7PLK6_VITVI Chromosome chr7 scaffold_20, whole genome... 78 2e-13
tr|A5B2K7|A5B2K7_VITVI Putative uncharacterized protein OS=Vitis... 78 2e-13
tr|A7PSZ8|A7PSZ8_VITVI Chromosome chr8 scaffold_29, whole genome... 77 4e-13
tr|A7PRH4|A7PRH4_VITVI Chromosome chr14 scaffold_27, whole genom... 77 6e-13
tr|A5AZT2|A5AZT2_VITVI Putative uncharacterized protein OS=Vitis... 77 6e-13
tr|A7QUT6|A7QUT6_VITVI Chromosome chr1 scaffold_180, whole genom... 76 7e-13
tr|Q6K297|Q6K297_ORYSJ Os09g0251500 protein OS=Oryza sativa subs... 75 1e-12
tr|Q5ZDP1|Q5ZDP1_ORYSJ cDNA, clone: J065053H11, full insert sequ... 75 1e-12
tr|Q0JMX0|Q0JMX0_ORYSJ Os01g0355100 protein OS=Oryza sativa subs... 75 1e-12
tr|A7Q3S4|A7Q3S4_VITVI Chromosome chr13 scaffold_48, whole genom... 75 1e-12
tr|A7PRN9|A7PRN9_VITVI Chromosome chr14 scaffold_27, whole genom... 75 1e-12
tr|A3BWH6|A3BWH6_ORYSJ Putative uncharacterized protein OS=Oryza... 75 1e-12
tr|A2ZSZ0|A2ZSZ0_ORYSJ Putative uncharacterized protein OS=Oryza... 75 1e-12
tr|Q6YSW0|Q6YSW0_ORYSJ Os07g0299800 protein OS=Oryza sativa subs... 75 2e-12
tr|Q1KUT6|Q1KUT6_9ROSI Putative uncharacterized protein OS=Cleom... 75 2e-12
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 75 2e-12
tr|A7R1A1|A7R1A1_VITVI Chromosome undetermined scaffold_342, who... 75 2e-12
tr|A5BIR2|A5BIR2_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A3AD43|A3AD43_ORYSJ Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|A2YKF2|A2YKF2_ORYSI Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|A7PAH3|A7PAH3_VITVI Chromosome chr14 scaffold_9, whole genome... 75 2e-12
tr|A5B3U0|A5B3U0_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|Q6ZKI7|Q6ZKI7_ORYSJ Os08g0138600 protein OS=Oryza sativa subs... 74 3e-12
tr|A7R3R7|A7R3R7_VITVI Chromosome undetermined scaffold_560, who... 74 3e-12
tr|A5BSF9|A5BSF9_VITVI Putative uncharacterized protein OS=Vitis... 74 3e-12

>tr|A9P0W0|A9P0W0_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 370

Score = 81.3 bits (199), Expect = 2e-14
Identities = 35/78 (44%), Positives = 52/78 (66%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
+++ G ELD + + LVD Y KCG + DA+ F +++ DV SW AM+ A+HGCG+EA
Sbjct: 24 IIKIGFELDVSVSNGLVDMYGKCGRIEDAQEVFSKLLEPDVASWNAMISGLAQHGCGKEA 83

Query: 56 LELMGKMLDSGVKLNHVT 3
+ L +ML +GVK N +T
Sbjct: 84 VLLFEQMLQTGVKPNQIT 101


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 79.3 bits (194), Expect = 9e-14
Identities = 34/78 (43%), Positives = 54/78 (69%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y ++SG E + + + LVD Y+KCG++ A+ F+ + + DVVSWT M++AY HG G++
Sbjct: 448 YTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAYGIHGHGED 507

Query: 59 ALELMGKMLDSGVKLNHV 6
AL L KM ++G KL+H+
Sbjct: 508 ALALFSKMQETGTKLDHI 525



Score = 63.5 bits (153), Expect = 5e-09
Identities = 30/78 (38%), Positives = 45/78 (57%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
++ G E D + + L Y+KCG L +AR FD + DVVSW A++ Y+++G EA
Sbjct: 146 IIARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEA 205

Query: 56 LELMGKMLDSGVKLNHVT 3
L L +M +G+K N T
Sbjct: 206 LALFSEMQVNGIKPNSST 223



Score = 60.8 bits (146), Expect = 3e-08
Identities = 28/79 (35%), Positives = 46/79 (58%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y ++SG+E D +V+ LV+ Y+KCG++ A F+ + DV SW A++ Y+ + E
Sbjct: 246 YAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHE 305

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL +M G+K N +T
Sbjct: 306 ALAFFNRMQVRGIKPNSIT 324



Score = 56.6 bits (135), Expect = 6e-07
Identities = 26/74 (35%), Positives = 45/74 (60%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y ++SG E + + + LV+ Y+KCG++ A F+ + +VV+W A++ Y++HG E
Sbjct: 347 YAIRSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHE 406

Query: 59 ALELMGKMLDSGVK 18
AL L +M G+K
Sbjct: 407 ALALFIEMQAQGIK 420


>tr|A5BS92|A5BS92_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032420 PE=4 SV=1
Length = 763

Score = 79.3 bits (194), Expect = 9e-14
Identities = 37/79 (46%), Positives = 54/79 (68%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y +++GL D + + L+D Y+KCG L AR FDS+I+ DVVSW+++++ YA+ G G+E
Sbjct: 494 YALKTGLNCDISVTNGLIDLYAKCGSLKTARKIFDSVINPDVVSWSSLILGYAQFGYGEE 553

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL+L M VK NHVT
Sbjct: 554 ALKLFKTMRRLDVKPNHVT 572



Score = 60.1 bits (144), Expect = 5e-08
Identities = 28/79 (35%), Positives = 50/79 (63%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
++++S D + + +++ Y KCG L DA+ FD++ + +VVSWT+++ Y+++G G
Sbjct: 88 HMLKSKSHPDLTLQNHILNMYGKCGSLKDAQKVFDAMPERNVVSWTSVIAGYSQNGQGGN 147

Query: 59 ALELMGKMLDSGVKLNHVT 3
ALE +ML SGV + T
Sbjct: 148 ALEFYFQMLQSGVMPDQFT 166



Score = 49.7 bits (117), Expect = 7e-05
Identities = 26/77 (33%), Positives = 42/77 (54%)
Frame = -1

Query: 233 VQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEAL 54
++ GL D F +L D Y+KCG L+ AR F I D+V+W A++ +A G +EA+
Sbjct: 293 IKFGLGRDVFAGCSLCDMYAKCGLLSCARVVFYQIGRPDLVAWNAIIAGFAYGGDAKEAI 352

Query: 53 ELMGKMLDSGVKLNHVT 3
+M G+ + +T
Sbjct: 353 AFFSQMRHQGLIPDEIT 369



Score = 48.9 bits (115), Expect = 1e-04
Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSI-IDHDVVSWTAMLVAYAKHGCGQ 63
Y+ + GL+LD + +TL+ Y+KC L DA F+ + + D+VSW A+L A H +
Sbjct: 392 YINKMGLDLDVPVCNTLLTMYAKCSELRDAIFFFEEMRCNADLVSWNAILTACMHHDQAE 451

Query: 62 EALELMGKMLDSGVKLNHVT 3
E L+ M S + +++T
Sbjct: 452 EVFGLLKLMCISQHRPDYIT 471



Score = 39.7 bits (91), Expect = 0.075
Identities = 21/75 (28%), Positives = 37/75 (49%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
+V++S + L+ Y+K + DA F + D++SW +M+ +++ G E
Sbjct: 189 HVLKSEFGAHIIAQNALISMYTKSNVIIDALDVFSRMATRDLISWGSMIAGFSQLGYELE 248

Query: 59 ALELMGKMLDSGVKL 15
AL +ML GV L
Sbjct: 249 ALCYFKEMLHQGVYL 263


>tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020655001
PE=4 SV=1
Length = 614

Score = 78.2 bits (191), Expect = 2e-13
Identities = 34/79 (43%), Positives = 53/79 (67%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
YV+Q+G E D + + ++D YSKCG L AR FD D+V W+AM+ +Y HG G++
Sbjct: 267 YVIQTGFEFDILVATAIMDMYSKCGSLDLARCLFDETAGKDLVCWSAMIASYGIHGHGRK 326

Query: 59 ALELMGKMLDSGVKLNHVT 3
A++L +M+ +GV+ +HVT
Sbjct: 327 AIDLFDQMVKAGVRPSHVT 345



Score = 61.6 bits (148), Expect = 2e-08
Identities = 32/79 (40%), Positives = 44/79 (55%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
++V G D F+ + LVD Y+KCG + AR FD + D+VSWT+M+ YA +G E
Sbjct: 166 HLVCCGCSNDLFVDAALVDMYAKCGDIEAARLVFDKMAVRDLVSWTSMISGYAHNGYNSE 225

Query: 59 ALELMGKMLDSGVKLNHVT 3
L M SGV N V+
Sbjct: 226 TLGFFDLMRSSGVIPNRVS 244



Score = 32.7 bits (73), Expect = 9.1
Identities = 18/69 (26%), Positives = 32/69 (46%)
Frame = -1

Query: 224 GLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELM 45
GL+ D+ +++ Y + A F+ I + W M+ +A G +LEL
Sbjct: 70 GLQYDSRILTKFAIMYVSFNRIDAASIVFEDIPNPCSFLWNVMIRGFATDGRFLSSLELY 129

Query: 44 GKMLDSGVK 18
KM++ G+K
Sbjct: 130 SKMMEKGLK 138


>tr|A7QPS9|A7QPS9_VITVI Chromosome chr10 scaffold_138, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00003060001
PE=4 SV=1
Length = 933

Score = 77.8 bits (190), Expect = 2e-13
Identities = 34/80 (42%), Positives = 54/80 (67%)
Frame = -1

Query: 242 VYVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQ 63
V++++ G LD F ++LV+ Y+KCG + DA AF + + +VSW+AM+ A+HG G+
Sbjct: 585 VHILKYGFVLDIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIVSWSAMIGGLAQHGHGR 644

Query: 62 EALELMGKMLDSGVKLNHVT 3
+AL+L +ML GV NH+T
Sbjct: 645 QALQLFNQMLKEGVSPNHIT 664



Score = 67.4 bits (163), Expect = 3e-10
Identities = 31/72 (43%), Positives = 49/72 (68%)
Frame = -1

Query: 233 VQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEAL 54
V+SG D ++V++L+D Y KC H+ DA F+ D+VS+T+M+ AYA++G G+EAL
Sbjct: 487 VKSGFHSDIYVVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEAL 546

Query: 53 ELMGKMLDSGVK 18
+L +M D +K
Sbjct: 547 KLFLEMQDMELK 558



Score = 62.8 bits (151), Expect = 8e-09
Identities = 31/79 (39%), Positives = 46/79 (58%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y+++ G + D F + LVD Y+K G L DA F+ I D+VSW A++ H ++
Sbjct: 283 YLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQPDIVSWNAVIAGCVLHEHHEQ 342

Query: 59 ALELMGKMLDSGVKLNHVT 3
ALEL+G+M SG+ N T
Sbjct: 343 ALELLGQMKRSGICPNIFT 361



Score = 59.3 bits (142), Expect = 9e-08
Identities = 31/75 (41%), Positives = 44/75 (58%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
VV SG E D F+ +TLV Y+KC D++ FD I + +VVSW A+ Y + EA
Sbjct: 183 VVVSGFEGDVFVANTLVVMYAKCDEFLDSKRLFDEIPERNVVSWNALFSCYVQIDFCGEA 242

Query: 56 LELMGKMLDSGVKLN 12
+ L +M+ SG+K N
Sbjct: 243 VGLFYEMVLSGIKPN 257



Score = 57.4 bits (137), Expect = 3e-07
Identities = 28/78 (35%), Positives = 46/78 (58%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
+++ +E D F+ LVD YSKC L DAR AF+ + + D+++W A++ Y+++ EA
Sbjct: 385 LMKMDMESDLFVSVGLVDMYSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEA 444

Query: 56 LELMGKMLDSGVKLNHVT 3
L L +M G+ N T
Sbjct: 445 LSLFVEMHKEGIGFNQTT 462



Score = 53.9 bits (128), Expect = 4e-06
Identities = 29/79 (36%), Positives = 45/79 (56%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
++ +SGL D + + L++ YSKC + AR D + D+VSW+A++ YA++G G
Sbjct: 81 HITKSGLSDDPSIRNHLINLYSKCRNFGYARKLVDESSEPDLVSWSALISGYAQNGLGGG 140

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL +M GVK N T
Sbjct: 141 ALMAFHEMHLLGVKCNEFT 159


>tr|A7PLK6|A7PLK6_VITVI Chromosome chr7 scaffold_20, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019609001
PE=4 SV=1
Length = 580

Score = 77.8 bits (190), Expect = 2e-13
Identities = 36/79 (45%), Positives = 50/79 (63%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y+ +G++ + + + LVD YSKCG L DAR FD I D DVV+W +M+V YA HG QE
Sbjct: 233 YIENNGIQFNVHVGTALVDMYSKCGSLEDARLVFDKIDDKDVVAWNSMIVGYAMHGFSQE 292

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL+L M G+ ++T
Sbjct: 293 ALQLFKSMCRMGLHPTNIT 311



Score = 46.2 bits (108), Expect = 8e-04
Identities = 24/66 (36%), Positives = 36/66 (54%)
Frame = -1

Query: 200 VSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEALELMGKMLDSGV 21
++ ++ Y+K G L AR FD + + D V W M+ Y ++G EAL L +ML +
Sbjct: 145 LTAMLTCYAKHGELDAARVLFDGMEERDGVCWNVMIDGYTQNGMPNEALVLFRRMLKAKA 204

Query: 20 KLNHVT 3
K N VT
Sbjct: 205 KPNEVT 210



Score = 35.4 bits (80), Expect = 1.4
Identities = 16/45 (35%), Positives = 27/45 (60%)
Frame = -1

Query: 206 FMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHG 72
F + ++ ++ G + A+ FD++ + +VS TAML YAKHG
Sbjct: 112 FFWTAIIHGHALRGDVVSAQQLFDTMPEKSLVSLTAMLTCYAKHG 156


>tr|A5B2K7|A5B2K7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023708 PE=4 SV=1
Length = 906

Score = 77.8 bits (190), Expect = 2e-13
Identities = 34/80 (42%), Positives = 54/80 (67%)
Frame = -1

Query: 242 VYVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQ 63
V++++ G LD F ++LV+ Y+KCG + DA AF + + +VSW+AM+ A+HG G+
Sbjct: 558 VHILKYGFVLDIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIVSWSAMIGGLAQHGHGR 617

Query: 62 EALELMGKMLDSGVKLNHVT 3
+AL+L +ML GV NH+T
Sbjct: 618 QALQLFNQMLKEGVSPNHIT 637



Score = 67.4 bits (163), Expect = 3e-10
Identities = 31/72 (43%), Positives = 49/72 (68%)
Frame = -1

Query: 233 VQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEAL 54
V+SG D ++V++L+D Y KC H+ DA F+ D+VS+T+M+ AYA++G G+EAL
Sbjct: 460 VKSGFHSDIYVVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEAL 519

Query: 53 ELMGKMLDSGVK 18
+L +M D +K
Sbjct: 520 KLFLEMQDMELK 531



Score = 60.1 bits (144), Expect = 5e-08
Identities = 31/75 (41%), Positives = 44/75 (58%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
VV SG E D F+ +TLV Y+KC D++ FD I + +VVSW A+ Y + EA
Sbjct: 183 VVVSGFEGDVFVANTLVVMYAKCDEFLDSKRLFDEIPERNVVSWNALFSCYVQXDFCGEA 242

Query: 56 LELMGKMLDSGVKLN 12
+ L +M+ SG+K N
Sbjct: 243 VGLFYEMVLSGIKPN 257



Score = 58.9 bits (141), Expect = 1e-07
Identities = 27/68 (39%), Positives = 41/68 (60%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y+++ G + D F + LVD Y+K G L DA F+ I D+VSW A++ H ++
Sbjct: 283 YLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQPDIVSWNAVIAGCVLHEHHEQ 342

Query: 59 ALELMGKM 36
ALEL+G+M
Sbjct: 343 ALELLGQM 350



Score = 57.4 bits (137), Expect = 3e-07
Identities = 28/78 (35%), Positives = 46/78 (58%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
+++ +E D F+ LVD YSKC L DAR AF+ + + D+++W A++ Y+++ EA
Sbjct: 358 LMKMDMESDLFVSVGLVDMYSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEA 417

Query: 56 LELMGKMLDSGVKLNHVT 3
L L +M G+ N T
Sbjct: 418 LSLFVEMHKEGIGFNQTT 435



Score = 53.1 bits (126), Expect = 7e-06
Identities = 29/79 (36%), Positives = 44/79 (55%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
++ +SGL D + + L++ YSKC AR D + D+VSW+A++ YA++G G
Sbjct: 81 HITKSGLSDDPSIRNHLINLYSKCRXFGYARKLVDESSEPDLVSWSALISGYAQNGLGGG 140

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL +M GVK N T
Sbjct: 141 ALMAFHEMHLLGVKCNEFT 159


>tr|A7PSZ8|A7PSZ8_VITVI Chromosome chr8 scaffold_29, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023152001
PE=4 SV=1
Length = 641

Score = 77.0 bits (188), Expect = 4e-13
Identities = 36/79 (45%), Positives = 53/79 (67%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
Y +++GL D + + L+D Y+KCG L A FDS+I+ DVVSW+++++ YA+ G G+E
Sbjct: 419 YALKTGLNCDTSVTNGLIDLYAKCGSLKTAHKIFDSMINPDVVSWSSLILGYAQFGYGEE 478

Query: 59 ALELMGKMLDSGVKLNHVT 3
AL+L M VK NHVT
Sbjct: 479 ALKLFKTMRRLDVKPNHVT 497



Score = 57.0 bits (136), Expect = 5e-07
Identities = 27/79 (34%), Positives = 49/79 (62%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
++++S D + + +++ Y KC L DA+ FD++ + +VVSWT+++ Y+++G G
Sbjct: 57 HMLKSKSHPDLTLQNHILNMYGKCKSLKDAQKVFDAMPERNVVSWTSVIAGYSQNGQGGN 116

Query: 59 ALELMGKMLDSGVKLNHVT 3
ALE +ML SGV + T
Sbjct: 117 ALEFYFQMLQSGVMPDQFT 135



Score = 50.8 bits (120), Expect = 3e-05
Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSI-IDHDVVSWTAMLVAYAKHGCGQ 63
Y+ + GL+LD + +TL+ Y+KC L DA F+ + + D+VSW A+L A +H +
Sbjct: 317 YINKMGLDLDVPVCNTLLTMYAKCSELRDAIFFFEEMRCNADLVSWNAILTACMRHDQAE 376

Query: 62 EALELMGKMLDSGVKLNHVT 3
E L+ M S + +++T
Sbjct: 377 EVFRLLKLMCISQHRPDYIT 396



Score = 39.7 bits (91), Expect = 0.075
Identities = 21/75 (28%), Positives = 37/75 (49%)
Frame = -1

Query: 239 YVVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQE 60
+V++S + L+ Y+K + DA F + D++SW +M+ +++ G E
Sbjct: 158 HVLKSEFGAHIIAQNALISMYTKSNLIIDALDVFSRMATRDLISWGSMIAGFSQLGYELE 217

Query: 59 ALELMGKMLDSGVKL 15
AL +ML GV L
Sbjct: 218 ALCYFKEMLHQGVYL 232


>tr|A7PRH4|A7PRH4_VITVI Chromosome chr14 scaffold_27, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022507001
PE=4 SV=1
Length = 691

Score = 76.6 bits (187), Expect = 6e-13
Identities = 32/78 (41%), Positives = 50/78 (64%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
+++ G + ++ +L+ Y+KCG L DA F+ I DH+V+SWTAM+ AY HGC +
Sbjct: 355 IIKLGYVKNMCILGSLITMYAKCGSLVDAYQVFEGIEDHNVISWTAMISAYQLHGCANQV 414

Query: 56 LELMGKMLDSGVKLNHVT 3
+EL ML G++ +HVT
Sbjct: 415 IELFEHMLSEGIEPSHVT 432



Score = 41.6 bits (96), Expect = 0.020
Identities = 16/47 (34%), Positives = 29/47 (61%)
Frame = -1

Query: 224 GLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAY 84
G + + F+ + LVD Y+KC + A FD + + ++VSW +M+V +
Sbjct: 156 GFDANIFVGTALVDMYAKCADMHSAVRVFDQMPERNLVSWNSMIVGF 202



Score = 39.7 bits (91), Expect = 0.075
Identities = 19/72 (26%), Positives = 37/72 (51%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
VV+ GL +++++L+D Y KC + F + D DVV+W +++ + ++ +EA
Sbjct: 254 VVKFGLVPLTYVMNSLMDMYFKCRFFDEGVKLFQCVGDRDVVTWNVLVMGFVQNDKFEEA 313

Query: 56 LELMGKMLDSGV 21
M G+
Sbjct: 314 CNYFWVMRREGI 325



Score = 37.0 bits (84), Expect = 0.48
Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 3/71 (4%)
Frame = -1

Query: 206 FMVSTLVDFYSKCGHLTDARHAFDSIIDH---DVVSWTAMLVAYAKHGCGQEALELMGKM 36
F+ + L++ Y+KCG L A F SI H +V+WT+++ + +AL L +M
Sbjct: 59 FLFNNLINLYAKCGCLNQALLLF-SITHHHFKTIVTWTSLITHLSHFNMHLQALSLFNQM 117

Query: 35 LDSGVKLNHVT 3
SG N T
Sbjct: 118 RCSGPYPNQFT 128


>tr|A5AZT2|A5AZT2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023383 PE=4 SV=1
Length = 820

Score = 76.6 bits (187), Expect = 6e-13
Identities = 32/78 (41%), Positives = 50/78 (64%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
+++ G + ++ +L+ Y+KCG L DA F+ I DH+V+SWTAM+ AY HGC +
Sbjct: 474 IIKLGYVKNMCILGSLITMYAKCGSLVDAYQVFEGIEDHNVISWTAMISAYQLHGCANQV 533

Query: 56 LELMGKMLDSGVKLNHVT 3
+EL ML G++ +HVT
Sbjct: 534 IELFEHMLSEGIEPSHVT 551



Score = 41.6 bits (96), Expect = 0.020
Identities = 16/47 (34%), Positives = 29/47 (61%)
Frame = -1

Query: 224 GLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAY 84
G + + F+ + LVD Y+KC + A FD + + ++VSW +M+V +
Sbjct: 275 GFDANIFVGTALVDMYAKCADMHSAVRVFDQMPERNLVSWNSMIVGF 321



Score = 39.7 bits (91), Expect = 0.075
Identities = 19/72 (26%), Positives = 37/72 (51%)
Frame = -1

Query: 236 VVQSGLELDAFMVSTLVDFYSKCGHLTDARHAFDSIIDHDVVSWTAMLVAYAKHGCGQEA 57
VV+ GL +++++L+D Y KC + F + D DVV+W +++ + ++ +EA
Sbjct: 373 VVKYGLVPLTYVMNSLMDMYFKCRFFDEGVKLFQCVGDRDVVTWNVLVMGFVQNDKFEEA 432

Query: 56 LELMGKMLDSGV 21
M G+
Sbjct: 433 CNYFWVMRREGI 444



Score = 37.0 bits (84), Expect = 0.48
Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 3/71 (4%)
Frame = -1

Query: 206 FMVSTLVDFYSKCGHLTDARHAFDSIIDH---DVVSWTAMLVAYAKHGCGQEALELMGKM 36
F+ + L++ Y+KCG L A F SI H +V+WT+++ + +AL L +M
Sbjct: 178 FLFNNLINLYAKCGCLNQALLLF-SITHHHFKTIVTWTSLITHLSHFNMHLQALSLFNQM 236

Query: 35 LDSGVKLNHVT 3
SG N T
Sbjct: 237 RCSGPYPNQFT 247