BP914208
Clone id YMU001_000056_C09
Library
Length 230
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000056_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATCGCTATGGTTCACGAGGGAGACTTAGGTTCATTAATGACCTAGGTAATACAAATTTG
TTCATTCATTCATTTTTTTGTGTAGTCATTGATCCGTTTTGTCGAGGATGAGGCCTTCAT
GGCTAATGTTACAAAACATACACACATTGTAAATGCATTGCTCATCATATGTGTGCTCAT
GATTATGGGCGGTCTTACCACAGAATATGTTTCTGGGAAGTGTCTAAAAA
■■Homology search results ■■ -
sp_hit_id Q8NGJ4
Definition sp|Q8NGJ4|O52E2_HUMAN Olfactory receptor 52E2 OS=Homo sapiens
Align length 76
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914208|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_C09.
(230 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8NGJ4|O52E2_HUMAN Olfactory receptor 52E2 OS=Homo sapiens GN... 30 3.8
sp|Q8YXF0|UVSE_ANASP UV DNA damage endonuclease OS=Anabaena sp. ... 29 6.5

>sp|Q8NGJ4|O52E2_HUMAN Olfactory receptor 52E2 OS=Homo sapiens
GN=OR52E2 PE=2 SV=1
Length = 325

Score = 30.0 bits (66), Expect = 3.8
Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 4/76 (5%)
Frame = +2

Query: 14 HEGDLGSLMT*VIQICSFIHFFV*SLIRFVEDEAFMANVTKHTHIVNALLIICVLMIMG- 190
HE L SL T +C + F+ +L F+ F NV ++ HI+ A L + V ++
Sbjct: 232 HEARLKSLSTCGSHVCVILAFYTPALFSFM-THCFGRNVPRYIHILLANLYVVVPPMLNP 290

Query: 191 ---GLTTEYVSGKCLK 229
G+ T+ + KC+K
Sbjct: 291 VIYGVRTKQIY-KCVK 305


>sp|Q8YXF0|UVSE_ANASP UV DNA damage endonuclease OS=Anabaena sp.
(strain PCC 7120) GN=uvsE PE=3 SV=1
Length = 322

Score = 29.3 bits (64), Expect = 6.5
Identities = 16/51 (31%), Positives = 24/51 (47%)
Frame = -2

Query: 220 LPRNIFCGKTAHNHEHTYDEQCIYNVCMFCNISHEGLILDKTDQ*LHKKMN 68
LP NI T N E+ Y + I+NVC I ++ D Q H+ ++
Sbjct: 196 LPENIKSRLTLENDEYAYSTEEIFNVCQKAQIP---MVFDAHHQICHENLD 243


tr_hit_id B7C079
Definition tr|B7C079|B7C079_9FIRM Putative uncharacterized protein OS=Roseburia intestinalis L1-82
Align length 44
Score (bit) 32.7
E-value 9.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914208|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_C09.
(230 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7C079|B7C079_9FIRM Putative uncharacterized protein OS=Roseb... 33 9.3
tr|A5DG13|A5DG13_PICGU Putative uncharacterized protein OS=Pichi... 33 9.3

>tr|B7C079|B7C079_9FIRM Putative uncharacterized protein
OS=Roseburia intestinalis L1-82 GN=ROSINTL182_02419 PE=4
SV=1
Length = 382

Score = 32.7 bits (73), Expect = 9.3
Identities = 15/44 (34%), Positives = 25/44 (56%)
Frame = +2

Query: 98 FVEDEAFMANVTKHTHIVNALLIICVLMIMGGLTTEYVSGKCLK 229
F D + A K + N+LLI +L ++GG+ T ++SG L+
Sbjct: 70 FANDFSIQAYNNKEDYKKNSLLISAILALIGGVVTYFISGHALR 113


>tr|A5DG13|A5DG13_PICGU Putative uncharacterized protein OS=Pichia
guilliermondii GN=PGUG_02214 PE=4 SV=2
Length = 558

Score = 32.7 bits (73), Expect = 9.3
Identities = 14/46 (30%), Positives = 28/46 (60%)
Frame = +2

Query: 47 VIQICSFIHFFV*SLIRFVEDEAFMANVTKHTHIVNALLIICVLMI 184
V +IC ++HFFV +L+ F+ + ++ ++ +L IIC+L +
Sbjct: 457 VSEICGYLHFFVSALLSIFICVFFLYTLLGYSALIGSLSIICLLPV 502