BP914210
Clone id YMU001_000056_C12
Library
Length 599
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000056_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGGAAGAATTCCGGCCTCGTTAGAAAACGTGCTTGAAAAATAAAATAAGATGCATTCTA
TCTAGGAGCACATTCACACGTGATGTTATGGAAAAGGGTTACCTGCTTGAGGAGAGTAAC
GGCAGTGGTGCCGCTGCAGAAGCAGTCAATGGAGGGATGTCTGTGCAGGTCGGTGTCCAT
AGCCTCGAATGCCTCGAGGAACGACTCCCTCCACTTCTCATACATCATCCCCACTCCTGC
TGGTTTTCTCAACAGAAAACCACAACAAATTTCAACTAAAAAATGAGCTACATCCAATTA
CCCCTAATTACCTCACTCTACAATCTGATTGGTCCTTAATACTCATGCATAATGATACCT
AAAATAGCCAGTAAAAATTTGATGATTAAACCCAACCCCTTCTCAAAATCAGCAGAGCTC
ACCATCATCAAACTGCTCTTGCCCTTTCAAGCTATTATTGTCACTGGACTTTACGTCGGT
TCCTGCCTCCTTCAGTGTAGCCGCTTCCGGCGAATTGGCCCACTTCAAATTCAAGTCTAG
TTCAGCAGCTGCTCCTGCTTCTTGTAACACATTGTCACCCCTCATCGAGTACCTGCAGG
■■Homology search results ■■ -
sp_hit_id Q8H4S6
Definition sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 OS=Oryza sativa subsp. japonica
Align length 47
Score (bit) 62.4
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914210|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_C12.
(599 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 OS=Oryz... 62 2e-09
sp|Q6ZKL8|P2C66_ORYSJ Probable protein phosphatase 2C 66 OS=Oryz... 55 3e-07
sp|Q2RBJ6|P2C73_ORYSJ Probable protein phosphatase 2C 73 OS=Oryz... 52 3e-06
sp|Q6K6N7|P2C14_ORYSJ Probable protein phosphatase 2C 14 OS=Oryz... 52 3e-06
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryz... 47 7e-05
sp|Q2R637|P2C75_ORYSJ Probable protein phosphatase 2C 75 OS=Oryz... 44 8e-04
sp|Q7XW27|P2C38_ORYSJ Probable protein phosphatase 2C 38 OS=Oryz... 43 0.001
sp|Q99MB1|TLR3_MOUSE Toll-like receptor 3 OS=Mus musculus GN=Tlr... 31 5.5

>sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 OS=Oryza
sativa subsp. japonica GN=Os07g0566200 PE=2 SV=2
Length = 427

Score = 62.4 bits (150), Expect = 2e-09
Identities = 26/47 (55%), Positives = 35/47 (74%)
Frame = -3

Query: 246 KPAGVGMMYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLK 106
+ +G M WR++F A++AMD DL HPS+DCFCSG+TAVT+LK
Sbjct: 115 RDSGADMPAAAWRKAFARAYKAMDKDLRSHPSLDCFCSGSTAVTVLK 161


>sp|Q6ZKL8|P2C66_ORYSJ Probable protein phosphatase 2C 66 OS=Oryza
sativa subsp. japonica GN=Os08g0500300 PE=2 SV=1
Length = 531

Score = 55.1 bits (131), Expect = 3e-07
Identities = 22/41 (53%), Positives = 33/41 (80%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
M+ ++S+ +AF+ MD +L HP++DCFCSG+TAVTL+KQ
Sbjct: 193 MFLPLKQSYFKAFKLMDKELKMHPTVDCFCSGSTAVTLVKQ 233


>sp|Q2RBJ6|P2C73_ORYSJ Probable protein phosphatase 2C 73 OS=Oryza
sativa subsp. japonica GN=Os11g0109000 PE=2 SV=1
Length = 420

Score = 51.6 bits (122), Expect = 3e-06
Identities = 20/37 (54%), Positives = 28/37 (75%)
Frame = -3

Query: 213 WRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
W+ F++ FE +D DL +H IDC CSGTTAVT+++Q
Sbjct: 132 WKNIFVKTFEDVDEDLRQHSGIDCICSGTTAVTVVRQ 168


>sp|Q6K6N7|P2C14_ORYSJ Probable protein phosphatase 2C 14 OS=Oryza
sativa subsp. japonica GN=Os02g0471500 PE=2 SV=1
Length = 518

Score = 51.6 bits (122), Expect = 3e-06
Identities = 25/36 (69%), Positives = 26/36 (72%)
Frame = -3

Query: 210 RESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
R SFL AF MD DL H SIDCF SGTTAV +LKQ
Sbjct: 234 RTSFLRAFNVMDRDLKLHKSIDCFFSGTTAVAVLKQ 269


>sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza
sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1
Length = 389

Score = 47.0 bits (110), Expect = 7e-05
Identities = 21/41 (51%), Positives = 28/41 (68%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
M E+WR++ AF AMD +L P++DC SGTTAV +KQ
Sbjct: 148 MLEEWRQACASAFAAMDGELKLQPNLDCAFSGTTAVCAIKQ 188


>sp|Q2R637|P2C75_ORYSJ Probable protein phosphatase 2C 75 OS=Oryza
sativa subsp. japonica GN=Os11g0417400 PE=2 SV=1
Length = 432

Score = 43.5 bits (101), Expect = 8e-04
Identities = 20/40 (50%), Positives = 28/40 (70%)
Frame = -3

Query: 222 YEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
+ +ESF +AF+ +D +L +ID CSGTTAVTL+KQ
Sbjct: 149 FNAMKESFRKAFKNVDKELKLQRNIDSICSGTTAVTLIKQ 188


>sp|Q7XW27|P2C38_ORYSJ Probable protein phosphatase 2C 38 OS=Oryza
sativa subsp. japonica GN=Os04g0321800 PE=2 SV=2
Length = 460

Score = 43.1 bits (100), Expect = 0.001
Identities = 22/41 (53%), Positives = 26/41 (63%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
M+ R S L AF MD DL H +ID SGTTAVT++KQ
Sbjct: 224 MFAALRTSLLRAFYVMDRDLKFHKTIDSVFSGTTAVTVIKQ 264


>sp|Q99MB1|TLR3_MOUSE Toll-like receptor 3 OS=Mus musculus GN=Tlr3
PE=1 SV=2
Length = 905

Score = 30.8 bits (68), Expect = 5.5
Identities = 18/46 (39%), Positives = 27/46 (58%)
Frame = +1

Query: 298 LPLITSLYNLIGP*YSCIMIPKIASKNLMIKPNPFSKSAELTIIKL 435
L L TS + L+ P +M+ ++A KN+ I P+PF LTI+ L
Sbjct: 470 LQLSTSSFALV-PSLQRLMLRRVALKNVDISPSPFRPLRNLTILDL 514


tr_hit_id B8LL70
Definition tr|B8LL70|B8LL70_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 41
Score (bit) 66.2
E-value 1.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914210|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_C12.
(599 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LL70|B8LL70_PICSI Putative uncharacterized protein OS=Picea... 66 1e-09
tr|A5BDP5|A5BDP5_VITVI Putative uncharacterized protein OS=Vitis... 65 3e-09
tr|A2YMQ6|A2YMQ6_ORYSI Putative uncharacterized protein OS=Oryza... 62 2e-08
tr|A7QQF9|A7QQF9_VITVI Chromosome undetermined scaffold_142, who... 62 3e-08
tr|B8LLH8|B8LLH8_PICSI Putative uncharacterized protein OS=Picea... 60 7e-08
tr|A5C3B0|A5C3B0_VITVI Putative uncharacterized protein (Chromos... 60 1e-07
tr|A9SE70|A9SE70_PHYPA Predicted protein (Fragment) OS=Physcomit... 60 1e-07
tr|A9SE69|A9SE69_PHYPA Predicted protein OS=Physcomitrella paten... 60 1e-07
tr|Q8GY60|Q8GY60_ARATH Putative uncharacterized protein (At4g034... 59 2e-07
tr|Q9M8R7|Q9M8R7_ARATH Putative uncharacterized protein F13E7.31... 59 2e-07
tr|Q8W4L2|Q8W4L2_ARATH Putative uncharacterized protein At3g0275... 59 2e-07
tr|Q2V3Z1|Q2V3Z1_ARATH Uncharacterized protein At3g02750.3 OS=Ar... 59 2e-07
tr|A7PV59|A7PV59_VITVI Chromosome chr4 scaffold_32, whole genome... 59 2e-07
tr|Q9LR65|Q9LR65_ARATH F21B7.20 OS=Arabidopsis thaliana PE=4 SV=1 58 4e-07
tr|Q8SBC2|Q8SBC2_ARATH Protein phosphatase 2C (Fragment) OS=Arab... 58 4e-07
tr|B6TT19|B6TT19_MAIZE Catalytic/ protein phosphatase type 2C OS... 58 4e-07
tr|Q4L0F8|Q4L0F8_MEDSA Protein phosphatase 2c OS=Medicago sativa... 58 5e-07
tr|B4FRP1|B4FRP1_MAIZE Putative uncharacterized protein OS=Zea m... 58 5e-07
tr|B4F8R0|B4F8R0_MAIZE Putative uncharacterized protein OS=Zea m... 58 5e-07
tr|A9PFS0|A9PFS0_POPTR Putative uncharacterized protein OS=Popul... 58 5e-07
tr|A6NA79|A6NA79_MEDTR Protein phosphatase 2c OS=Medicago trunca... 58 5e-07
tr|Q8SBC3|Q8SBC3_ARATH Protein phosphatase 2C (Fragment) OS=Arab... 57 1e-06
tr|A9RFU1|A9RFU1_PHYPA Predicted protein OS=Physcomitrella paten... 56 2e-06
tr|B8A3S3|B8A3S3_MAIZE Putative uncharacterized protein OS=Zea m... 55 2e-06
tr|B6U7X6|B6U7X6_MAIZE Catalytic/ protein phosphatase type 2C OS... 52 3e-05
tr|B8AHJ8|B8AHJ8_ORYSI Putative uncharacterized protein OS=Oryza... 52 3e-05
tr|A3C7U9|A3C7U9_ORYSJ Putative uncharacterized protein OS=Oryza... 52 3e-05
tr|A3A6R3|A3A6R3_ORYSJ Putative uncharacterized protein OS=Oryza... 52 3e-05
tr|A2ZAN9|A2ZAN9_ORYSI Putative uncharacterized protein OS=Oryza... 52 3e-05
tr|Q9MA12|Q9MA12_ARATH F20B17.6 OS=Arabidopsis thaliana PE=4 SV=1 51 6e-05

>tr|B8LL70|B8LL70_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 523

Score = 66.2 bits (160), Expect = 1e-09
Identities = 29/41 (70%), Positives = 34/41 (82%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
M W+ESFL+AF+ MD +L HP+IDCFCSGTTAVTLLKQ
Sbjct: 181 MLTAWKESFLKAFKVMDKELRFHPTIDCFCSGTTAVTLLKQ 221


>tr|A5BDP5|A5BDP5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004560 PE=4 SV=1
Length = 441

Score = 65.1 bits (157), Expect = 3e-09
Identities = 31/51 (60%), Positives = 39/51 (76%), Gaps = 1/51 (1%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQV-TLFHNITC 76
MY +ESFL+AF+ MD +L HP+IDCFCSGTTAVTL+KQ+ + N TC
Sbjct: 122 MYLPLKESFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQLEKMISNTTC 172


>tr|A2YMQ6|A2YMQ6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26509 PE=4 SV=1
Length = 427

Score = 62.4 bits (150), Expect = 2e-08
Identities = 26/47 (55%), Positives = 35/47 (74%)
Frame = -3

Query: 246 KPAGVGMMYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLK 106
+ +G M WR++F A++AMD DL HPS+DCFCSG+TAVT+LK
Sbjct: 115 RDSGADMPAAAWRKAFARAYKAMDKDLRSHPSLDCFCSGSTAVTVLK 161


>tr|A7QQF9|A7QQF9_VITVI Chromosome undetermined scaffold_142, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00003341001 PE=4 SV=1
Length = 330

Score = 62.0 bits (149), Expect = 3e-08
Identities = 28/41 (68%), Positives = 34/41 (82%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
MY +ESFL+AF+ MD +L HP+IDCFCSGTTAVTL+KQ
Sbjct: 20 MYLPLKESFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQ 60


>tr|B8LLH8|B8LLH8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 526

Score = 60.5 bits (145), Expect = 7e-08
Identities = 26/36 (72%), Positives = 32/36 (88%)
Frame = -3

Query: 210 RESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
+ESFL+AF+ MD +L HP+IDCFCSGTTAVTL+KQ
Sbjct: 182 KESFLKAFKVMDKELRLHPTIDCFCSGTTAVTLVKQ 217


>tr|A5C3B0|A5C3B0_VITVI Putative uncharacterized protein (Chromosome
chr12 scaffold_36, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00025997001 PE=4 SV=1
Length = 473

Score = 60.1 bits (144), Expect = 1e-07
Identities = 22/37 (59%), Positives = 34/37 (91%)
Frame = -3

Query: 213 WRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
WRE+FL++++AMD +L HP++DCFCSG+TAVT+++Q
Sbjct: 167 WREAFLKSYKAMDKELRSHPNLDCFCSGSTAVTIVRQ 203


>tr|A9SE70|A9SE70_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_13857 PE=4 SV=1
Length = 399

Score = 59.7 bits (143), Expect = 1e-07
Identities = 24/41 (58%), Positives = 31/41 (75%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
M++ W+E+ L + MD +L HP IDCFCSGTTAVT+LKQ
Sbjct: 100 MFDVWKEAHLTGYRIMDKELRSHPGIDCFCSGTTAVTVLKQ 140


>tr|A9SE69|A9SE69_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_184002 PE=4 SV=1
Length = 490

Score = 59.7 bits (143), Expect = 1e-07
Identities = 26/41 (63%), Positives = 31/41 (75%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
M+ W+ES L AF+ MD +L HP IDCFCSGTT VT+LKQ
Sbjct: 156 MFGPWKESHLLAFKEMDQELRMHPVIDCFCSGTTTVTVLKQ 196


>tr|Q8GY60|Q8GY60_ARATH Putative uncharacterized protein (At4g03415)
OS=Arabidopsis thaliana PE=2 SV=1
Length = 468

Score = 59.3 bits (142), Expect = 2e-07
Identities = 23/37 (62%), Positives = 32/37 (86%)
Frame = -3

Query: 213 WRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
W E+FL++F+AMD +L HP++DCFCSG+T VT+LKQ
Sbjct: 168 WGEAFLKSFKAMDKELRSHPNLDCFCSGSTGVTILKQ 204


>tr|Q9M8R7|Q9M8R7_ARATH Putative uncharacterized protein F13E7.31
(At3g02750) OS=Arabidopsis thaliana GN=At3g02750 PE=2
SV=1
Length = 492

Score = 58.9 bits (141), Expect = 2e-07
Identities = 25/41 (60%), Positives = 34/41 (82%)
Frame = -3

Query: 225 MYEKWRESFLEAFEAMDTDLHRHPSIDCFCSGTTAVTLLKQ 103
+++ +ESFL+AF+ MD +L H S+DCFCSGTTAVTL+KQ
Sbjct: 185 LFQTLKESFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQ 225