BP914227
Clone id YMU001_000056_E06
Library
Length 583
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000056_E06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATGTCGAACTAGACGAACAGCAGATAGAGAAGGTATCTCGGCAAAGAATGGCGTGATTGG
AGCTGAGAGTGGTTCAAAAGGCATTCAACAGACTGATATGTTTTCAAATCAATCCATCAA
CTCCAAAGGTTCCGTCACTTCTAGTGCAAATAAACCACTAGATGACAGACTATAAGAAAA
GATTCTTCTCCTGTGTGGACCTCCAGGGCTTGGTAAAACAACTCTTGCTCATGTTGCTGC
AAGGCATTGTGGATACCGAGTTGTTGAGATAAATGCAAGTGATGATCGGGTGTTGTCAAC
CTTGCAAGCAAAAATATTGGATGCAGTTCAAATGAAATCTGTCATGGGTGATTTAAGACC
CAATTGTGTGGTGATTGATGAAATTGATGGAGCACTTGGAGGTGCAGATGGAAAGGGTGC
GATAGATGCTCTCTTGAAAATTGCTTATGCTGGAACAAAGGAACTTTCAGGGAAGGTGAA
CGAGAAAGATGAAGCAGTGATTAAGAAGGCATCCAAAAAGAACACATCCACAACTGCGAC
ACTTTCACGACCTGTTATTTGCATCTGCAATGATCCATATGCT
■■Homology search results ■■ -
sp_hit_id Q6NU40
Definition sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 18 homolog OS=Xenopus laevis
Align length 138
Score (bit) 109.0
E-value 1.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914227|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_E06.
(583 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 1... 109 1e-23
sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 1... 100 5e-21
sp|Q8BIW9|CTF18_MOUSE Chromosome transmission fidelity protein 1... 99 2e-20
sp|P0C1D3|CTF18_EMENI Chromosome transmission fidelity protein 1... 82 3e-15
sp|Q9USQ1|CTF18_SCHPO Chromosome transmission fidelity protein 1... 78 3e-14
sp|P49956|CTF18_YEAST Chromosome transmission fidelity protein 1... 75 2e-13
sp|A1RWU6|RFCL_THEPD Replication factor C large subunit OS=Therm... 57 9e-08
sp|O60182|RFC1_SCHPO Replication factor C subunit 1 OS=Schizosac... 56 1e-07
sp|P38630|RFC1_YEAST Replication factor C subunit 1 OS=Saccharom... 55 2e-07
sp|A4WGV3|RFCL_PYRAR Replication factor C large subunit OS=Pyrob... 55 3e-07
sp|A4FZL6|RFCL_METM5 Replication factor C large subunit OS=Metha... 55 3e-07
sp|Q58294|RFCL_METJA Replication factor C large subunit OS=Metha... 55 3e-07
sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapi... 55 3e-07
sp|Q8ZYK3|RFCL_PYRAE Replication factor C large subunit OS=Pyrob... 54 4e-07
sp|P35601|RFC1_MOUSE Replication factor C subunit 1 OS=Mus muscu... 54 6e-07
sp|Q2NH88|RFCL_METST Replication factor C large subunit OS=Metha... 53 1e-06
sp|Q6M0E9|RFCL_METMP Replication factor C large subunit OS=Metha... 53 1e-06
sp|Q5JHP1|RFCL_PYRKO Replication factor C large subunit OS=Pyroc... 53 1e-06
sp|A6VIW1|RFCL_METM7 Replication factor C large subunit OS=Metha... 53 1e-06
sp|A6URV8|RFCL_METVS Replication factor C large subunit OS=Metha... 52 2e-06
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyroc... 52 2e-06
sp|Q12TX1|RFCL_METBU Replication factor C large subunit OS=Metha... 52 2e-06
sp|O57853|RFCL_PYRHO Replication factor C large subunit OS=Pyroc... 52 3e-06
sp|A3MS27|RFCL_PYRCJ Replication factor C large subunit OS=Pyrob... 52 3e-06
sp|A5UMF4|RFCL_METS3 Replication factor C large subunit OS=Metha... 51 5e-06
sp|A1RSA3|RFCL_PYRIL Replication factor C large subunit OS=Pyrob... 50 6e-06
sp|A6UWR5|RFCL_META3 Replication factor C large subunit OS=Metha... 50 1e-05
sp|Q8TPU4|RFCL_METAC Replication factor C large subunit OS=Metha... 49 1e-05
sp|P35600|RFC1_DROME Replication factor C subunit 1 OS=Drosophil... 49 1e-05
sp|Q9UWR2|RFCL_PYRFU Replication factor C large subunit OS=Pyroc... 49 2e-05

>sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 18
homolog OS=Xenopus laevis GN=chtf18 PE=2 SV=1
Length = 1000

Score = 109 bits (272), Expect = 1e-23
Identities = 64/138 (46%), Positives = 77/138 (55%), Gaps = 4/138 (2%)
Frame = +2

Query: 179 KILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMG-DL 355
K+ LLCGPPGLGKTTLAHV ARH GY VVE+NASDDR + +I A QMKSV+G D
Sbjct: 390 KVSLLCGPPGLGKTTLAHVIARHAGYNVVEMNASDDRSPEAFRTRIEAATQMKSVLGVDE 449

Query: 356 RPNCVVIDE---XXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXX 526
RPNC++IDE K A GT+ +GK +K+ +
Sbjct: 450 RPNCLIIDEIDGAPTVSINMLLSLVNRKDAKEAEGGTEATTGKKKKKEGGL--------- 500

Query: 527 XXXXXLSRPVICICNDPY 580
L RP+ICICND Y
Sbjct: 501 -----LLRPIICICNDQY 513


>sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18
homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1
Length = 975

Score = 100 bits (249), Expect = 5e-21
Identities = 61/137 (44%), Positives = 74/137 (54%), Gaps = 1/137 (0%)
Frame = +2

Query: 176 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMG-D 352
+K+ LLCGPPGLGKTTLAHV ARH GY VVE+NASDDR + +I A QM+SV+G
Sbjct: 367 QKVALLCGPPGLGKTTLAHVIARHAGYSVVEMNASDDRSPEVFRTRIEAATQMESVLGAG 426

Query: 353 LRPNCVVIDEXXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXX 532
+PNC+VIDE K G +E V + AV
Sbjct: 427 GKPNCLVIDEIDGAPVAAINVLLSILNRK----GPQE----VGPQGPAVPSGGGRRRRAE 478

Query: 533 XXXLSRPVICICNDPYA 583
L RP+ICICND +A
Sbjct: 479 GGLLMRPIICICNDQFA 495


>sp|Q8BIW9|CTF18_MOUSE Chromosome transmission fidelity protein 18
homolog OS=Mus musculus GN=Chtf18 PE=2 SV=2
Length = 969

Score = 98.6 bits (244), Expect = 2e-20
Identities = 60/140 (42%), Positives = 74/140 (52%), Gaps = 5/140 (3%)
Frame = +2

Query: 176 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMG-D 352
+K+ LLCGPPGLGKTTLAHV ARH GY VVE+NASDDR + +I A QM+SV+G
Sbjct: 362 QKVALLCGPPGLGKTTLAHVVARHAGYCVVEMNASDDRSPEAFRTRIEAATQMESVLGVG 421

Query: 353 LRPNCVVIDEXXXXXXXXXXXXXXXXXXK----IAYAGTKELSGKVNEKDEAVIXXXXXX 520
RPNC+VIDE K GT +G + E +
Sbjct: 422 GRPNCLVIDEIDGAPTAAINVLLGILNRKGPQEADQGGTAVAAGGRRRRAEGGL------ 475

Query: 521 XXXXXXXLSRPVICICNDPY 580
L+RP+ICICND +
Sbjct: 476 -------LTRPIICICNDQF 488


>sp|P0C1D3|CTF18_EMENI Chromosome transmission fidelity protein 18
OS=Emericella nidulans GN=ctf18 PE=3 SV=1
Length = 993

Score = 81.6 bits (200), Expect = 3e-15
Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 12/90 (13%)
Frame = +2

Query: 149 NKPLDDRL*EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAV 328
N ++R K+LLLCGPPGLGKTTLAHV AR GY V+EINASD+R ++ +I DA+
Sbjct: 305 NNDEEERPHRKVLLLCGPPGLGKTTLAHVCARQAGYEVLEINASDERSRDVVKGRIRDAL 364

Query: 329 QMKSVMG---DL---------RPNCVVIDE 382
++V G +L RP CVV+DE
Sbjct: 365 GTENVKGMNVELGEQKVRKVGRPVCVVVDE 394


>sp|Q9USQ1|CTF18_SCHPO Chromosome transmission fidelity protein 18
OS=Schizosaccharomyces pombe GN=ctf18 PE=1 SV=1
Length = 960

Score = 78.2 bits (191), Expect = 3e-14
Identities = 50/139 (35%), Positives = 65/139 (46%)
Frame = +2

Query: 164 DRL*EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSV 343
DR ++I++L G G GKTTLAHV A GY+V+EINASDDR T+ K+ A+ S
Sbjct: 412 DRPDKRIMMLTGLAGAGKTTLAHVIAHQAGYKVLEINASDDRTAHTVHEKVSSAISNHSA 471

Query: 344 MGDLRPNCVVIDEXXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXX 523
+ +P CV++DE A E K E +A
Sbjct: 472 LSS-QPTCVIVDEIDGGDPAFVR----------ALLSLLESDEKATEYSQA----GNSKK 516

Query: 524 XXXXXXLSRPVICICNDPY 580
L RP+ICICND Y
Sbjct: 517 KKKFKKLCRPIICICNDLY 535


>sp|P49956|CTF18_YEAST Chromosome transmission fidelity protein 18
OS=Saccharomyces cerevisiae GN=CTF18 PE=1 SV=1
Length = 741

Score = 75.5 bits (184), Expect = 2e-13
Identities = 49/136 (36%), Positives = 69/136 (50%)
Frame = +2

Query: 176 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDL 355
+KILLL GPPG+GKT++AHV A+ G+ V EINASD+R ++ KI + + + D
Sbjct: 176 KKILLLHGPPGIGKTSVAHVIAKQSGFSVSEINASDERAGPMVKEKIYNLLFNHTF--DT 233

Query: 356 RPNCVVIDEXXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXX 535
P C+V DE A K L G+ ++KD+
Sbjct: 234 NPVCLVADEIDGSIESGFIRILVDIMQSDIKATNKLLYGQPDKKDK-------KRKKKRS 286

Query: 536 XXLSRPVICICNDPYA 583
L+RP+ICICN+ YA
Sbjct: 287 KLLTRPIICICNNLYA 302


>sp|A1RWU6|RFCL_THEPD Replication factor C large subunit
OS=Thermofilum pendens (strain Hrk 5) GN=rfcL PE=3 SV=1
Length = 413

Score = 56.6 bits (135), Expect = 9e-08
Identities = 25/58 (43%), Positives = 38/58 (65%)
Frame = +2

Query: 176 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMG 349
+K LL GPPG GKT++ H A+ + ++E+NASD R LQ ++L A+ +SV+G
Sbjct: 47 KKAALLYGPPGSGKTSIVHATAKEFSWELIELNASDVRTREALQQRLLGALNTRSVLG 104


>sp|O60182|RFC1_SCHPO Replication factor C subunit 1
OS=Schizosaccharomyces pombe GN=rfc1 PE=1 SV=1
Length = 934

Score = 56.2 bits (134), Expect = 1e-07
Identities = 32/71 (45%), Positives = 43/71 (60%), Gaps = 1/71 (1%)
Frame = +2

Query: 140 SSANKPLDDRL*-EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKI 316
S+ NKP D L K +LL GPPG+GKTT AH+ A+ GY V+E+NASD R L ++
Sbjct: 396 SNFNKPGPDGLGLYKAVLLSGPPGIGKTTAAHLVAKLEGYDVLELNASDTRSKRLLDEQL 455

Query: 317 LDAVQMKSVMG 349
+S+ G
Sbjct: 456 FGVTDSQSLAG 466


>sp|P38630|RFC1_YEAST Replication factor C subunit 1
OS=Saccharomyces cerevisiae GN=RFC1 PE=1 SV=1
Length = 861

Score = 55.5 bits (132), Expect = 2e-07
Identities = 27/59 (45%), Positives = 39/59 (66%)
Frame = +2

Query: 188 LLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRPN 364
+L GPPG+GKTT AH+ A+ GY ++E NASD R + L A + +A+ SV+G + N
Sbjct: 350 MLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHN 408


>sp|A4WGV3|RFCL_PYRAR Replication factor C large subunit
OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM
11321) GN=rfcL PE=3 SV=1
Length = 422

Score = 55.1 bits (131), Expect = 3e-07
Identities = 30/75 (40%), Positives = 42/75 (56%)
Frame = +2

Query: 125 KGSVTSSANKPLDDRL*EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTL 304
K T A K + L + +LL GPPG+GKTTL H AR GY ++E+NASD R L
Sbjct: 39 KDFCTRWAKKKDKEILDARAVLLAGPPGVGKTTLIHALAREIGYELIELNASDVRTAERL 98

Query: 305 QAKILDAVQMKSVMG 349
+ + ++ S+ G
Sbjct: 99 KEVVGRGLREGSLFG 113


tr_hit_id A9RCL3
Definition tr|A9RCL3|A9RCL3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 177
Score (bit) 157.0
E-value 5.0e-37
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914227|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_E06.
(583 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RCL3|A9RCL3_PHYPA Predicted protein OS=Physcomitrella paten... 157 5e-37
tr|Q84QB4|Q84QB4_ORYSJ Putative uncharacterized protein OJ1012B0... 134 5e-30
tr|Q10NN1|Q10NN1_ORYSJ ATPase, AAA family protein, expressed OS=... 134 5e-30
tr|Q0DT80|Q0DT80_ORYSJ Os03g0264800 protein OS=Oryza sativa subs... 134 5e-30
tr|B8AKQ6|B8AKQ6_ORYSI Putative uncharacterized protein OS=Oryza... 134 5e-30
tr|A3AGC1|A3AGC1_ORYSJ Putative uncharacterized protein OS=Oryza... 134 5e-30
tr|A5CB86|A5CB86_VITVI Putative uncharacterized protein OS=Vitis... 133 8e-30
tr|A7R3W8|A7R3W8_VITVI Chromosome undetermined scaffold_582, who... 131 2e-29
tr|A7R4P1|A7R4P1_VITVI Chromosome undetermined scaffold_749, who... 129 1e-28
tr|A7R4I9|A7R4I9_VITVI Chromosome undetermined scaffold_702, who... 120 7e-26
tr|A7R600|A7R600_VITVI Chromosome undetermined scaffold_1105, wh... 118 2e-25
tr|A7R3A1|A7R3A1_VITVI Chromosome undetermined scaffold_496, who... 116 1e-24
tr|A7R4C5|A7R4C5_VITVI Chromosome undetermined scaffold_649, who... 114 4e-24
tr|A7R7D0|A7R7D0_VITVI Chromosome undetermined scaffold_1704, wh... 112 1e-23
tr|A7R624|A7R624_VITVI Chromosome undetermined scaffold_1134, wh... 112 1e-23
tr|O23012|O23012_ARATH T1G11.2 protein OS=Arabidopsis thaliana G... 108 2e-22
tr|A8ISE0|A8ISE0_CHLRE DNA damage repair and chromosome cohesion... 105 1e-21
tr|Q16Z43|Q16Z43_AEDAE Putative uncharacterized protein OS=Aedes... 104 4e-21
tr|Q16Z42|Q16Z42_AEDAE Putative uncharacterized protein OS=Aedes... 104 4e-21
tr|Q5ZHX0|Q5ZHX0_CHICK Putative uncharacterized protein (Fragmen... 103 9e-21
tr|A4S9K8|A4S9K8_OSTLU Predicted protein (Fragment) OS=Ostreococ... 103 9e-21
tr|B0XJM8|B0XJM8_CULQU Chromosome transmission fidelity protein ... 103 9e-21
tr|A7RJV2|A7RJV2_NEMVE Predicted protein (Fragment) OS=Nematoste... 102 2e-20
tr|B3RMJ4|B3RMJ4_TRIAD Putative uncharacterized protein OS=Trich... 100 5e-20
tr|Q96S08|Q96S08_HUMAN Protein CTF18 homolog. OS=Homo sapiens GN... 100 6e-20
tr|Q7Z6Y4|Q7Z6Y4_HUMAN CTF18, chromosome transmission fidelity f... 100 6e-20
tr|B7ZBA2|B7ZBA2_HUMAN CTF18, chromosome transmission fidelity f... 100 6e-20
tr|A5AY69|A5AY69_VITVI Putative uncharacterized protein OS=Vitis... 99 2e-19
tr|B4JQJ0|B4JQJ0_DROGR GH13174 OS=Drosophila grimshawi GN=GH1317... 99 2e-19
tr|B4LRR8|B4LRR8_DROVI GJ17580 OS=Drosophila virilis GN=GJ17580 ... 97 5e-19

>tr|A9RCL3|A9RCL3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64140 PE=4 SV=1
Length = 1081

Score = 157 bits (396), Expect = 5e-37
Identities = 91/177 (51%), Positives = 105/177 (59%), Gaps = 2/177 (1%)
Frame = +2

Query: 59 GAESGSKGIQQTDMFSNQSINSKGS-VTSSANKPLDDRL*EKILLLCGPPGLGKTTLAHV 235
G S + + ++ + N + NS + ++ K DR EK+LLLCGPPGLGKTTLAHV
Sbjct: 424 GRGSFNNNVNKSMAYRNDTFNSDSTRKVATEEKSTLDRPEEKVLLLCGPPGLGKTTLAHV 483

Query: 236 AARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDEXXXXXXXXXXX 415
AARHCGYRVVEINASDDRV +TLQ KILDA+QMKSV GD RPNC+VIDE
Sbjct: 484 AARHCGYRVVEINASDDRVATTLQGKILDAIQMKSVTGDNRPNCLVIDEIDGALSGAEGK 543

Query: 416 XXXXXXXKIAYAGTKELSGKVNEKDEAVI-XXXXXXXXXXXXXLSRPVICICNDPYA 583
+I A K GK NE E V LSRPVICICND YA
Sbjct: 544 GAIDSLLEIINADKKSSLGKENEMQEGVTKVSSKKTGGSAVRRLSRPVICICNDFYA 600


>tr|Q84QB4|Q84QB4_ORYSJ Putative uncharacterized protein OJ1012B02.7
OS=Oryza sativa subsp. japonica GN=OJ1012B02.7 PE=4 SV=1
Length = 973

Score = 134 bits (336), Expect = 5e-30
Identities = 79/184 (42%), Positives = 96/184 (52%), Gaps = 2/184 (1%)
Frame = +2

Query: 38 SAKNGVIGAESGSKGIQQTDMFSNQSINSKGSVTSSANK-PLDDRL*E-KILLLCGPPGL 211
S+ G G+ Q +M N ++ +TSS NK P D E K+LLLCGPPGL
Sbjct: 307 SSNRNFFSKSKGGPGMSQDNMLQNAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGL 366

Query: 212 GKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDEXXX 391
GKTTLAHVAA+HCGY VVEINASDDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 367 GKTTLAHVAAKHCGYHVVEINASDDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE--- 423

Query: 392 XXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXXXXLSRPVICICN 571
+ K S + E L RPVICICN
Sbjct: 424 -----IDGALGDGKGAVEINAEKNNSSNSSTSAEDTQVRKSSKKGHKIPKLMRPVICICN 478

Query: 572 DPYA 583
D YA
Sbjct: 479 DLYA 482


>tr|Q10NN1|Q10NN1_ORYSJ ATPase, AAA family protein, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os03g15810 PE=4
SV=1
Length = 1002

Score = 134 bits (336), Expect = 5e-30
Identities = 79/184 (42%), Positives = 96/184 (52%), Gaps = 2/184 (1%)
Frame = +2

Query: 38 SAKNGVIGAESGSKGIQQTDMFSNQSINSKGSVTSSANK-PLDDRL*E-KILLLCGPPGL 211
S+ G G+ Q +M N ++ +TSS NK P D E K+LLLCGPPGL
Sbjct: 307 SSNRNFFSKSKGGPGMSQDNMLQNAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGL 366

Query: 212 GKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDEXXX 391
GKTTLAHVAA+HCGY VVEINASDDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 367 GKTTLAHVAAKHCGYHVVEINASDDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE--- 423

Query: 392 XXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXXXXLSRPVICICN 571
+ K S + E L RPVICICN
Sbjct: 424 -----IDGALGDGKGAVEINAEKNNSSNSSTSAEDTQVRKSSKKGHKIPKLMRPVICICN 478

Query: 572 DPYA 583
D YA
Sbjct: 479 DLYA 482


>tr|Q0DT80|Q0DT80_ORYSJ Os03g0264800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0264800 PE=4 SV=1
Length = 973

Score = 134 bits (336), Expect = 5e-30
Identities = 79/184 (42%), Positives = 96/184 (52%), Gaps = 2/184 (1%)
Frame = +2

Query: 38 SAKNGVIGAESGSKGIQQTDMFSNQSINSKGSVTSSANK-PLDDRL*E-KILLLCGPPGL 211
S+ G G+ Q +M N ++ +TSS NK P D E K+LLLCGPPGL
Sbjct: 307 SSNRNFFSKSKGGPGMSQDNMLQNAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGL 366

Query: 212 GKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDEXXX 391
GKTTLAHVAA+HCGY VVEINASDDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 367 GKTTLAHVAAKHCGYHVVEINASDDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE--- 423

Query: 392 XXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXXXXLSRPVICICN 571
+ K S + E L RPVICICN
Sbjct: 424 -----IDGALGDGKGAVEINAEKNNSSNSSTSAEDTQVRKSSKKGHKIPKLMRPVICICN 478

Query: 572 DPYA 583
D YA
Sbjct: 479 DLYA 482


>tr|B8AKQ6|B8AKQ6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10859 PE=4 SV=1
Length = 897

Score = 134 bits (336), Expect = 5e-30
Identities = 79/184 (42%), Positives = 96/184 (52%), Gaps = 2/184 (1%)
Frame = +2

Query: 38 SAKNGVIGAESGSKGIQQTDMFSNQSINSKGSVTSSANK-PLDDRL*E-KILLLCGPPGL 211
S+ G G+ Q +M N ++ +TSS NK P D E K+LLLCGPPGL
Sbjct: 247 SSNRNFFSKSKGGPGMSQDNMLQNAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGL 306

Query: 212 GKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDEXXX 391
GKTTLAHVAA+HCGY VVEINASDDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 307 GKTTLAHVAAKHCGYHVVEINASDDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE--- 363

Query: 392 XXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXXXXLSRPVICICN 571
+ K S + E L RPVICICN
Sbjct: 364 -----IDGALGDGKGAVEINAEKNNSSNSSTSAEDTQVRKSSKKGHKIPKLMRPVICICN 418

Query: 572 DPYA 583
D YA
Sbjct: 419 DLYA 422


>tr|A3AGC1|A3AGC1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009843 PE=4 SV=1
Length = 1350

Score = 134 bits (336), Expect = 5e-30
Identities = 79/184 (42%), Positives = 96/184 (52%), Gaps = 2/184 (1%)
Frame = +2

Query: 38 SAKNGVIGAESGSKGIQQTDMFSNQSINSKGSVTSSANK-PLDDRL*E-KILLLCGPPGL 211
S+ G G+ Q +M N ++ +TSS NK P D E K+LLLCGPPGL
Sbjct: 307 SSNRNFFSKSKGGPGMSQDNMLQNAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGL 366

Query: 212 GKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDEXXX 391
GKTTLAHVAA+HCGY VVEINASDDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 367 GKTTLAHVAAKHCGYHVVEINASDDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE--- 423

Query: 392 XXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXXXXLSRPVICICN 571
+ K S + E L RPVICICN
Sbjct: 424 -----IDGALGDGKGAVEINAEKNNSSNSSTSAEDTQVRKSSKKGHKIPKLMRPVICICN 478

Query: 572 DPYA 583
D YA
Sbjct: 479 DLYA 482


>tr|A5CB86|A5CB86_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003510 PE=4 SV=1
Length = 169

Score = 133 bits (334), Expect = 8e-30
Identities = 74/135 (54%), Positives = 81/135 (60%)
Frame = +2

Query: 179 KILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLR 358
KILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR ST++AKILD VQM SVM D +
Sbjct: 26 KILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSTIEAKILDVVQMNSVMADSK 85

Query: 359 PNCVVIDEXXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXXX 538
PNC+VIDE G V + DE+
Sbjct: 86 PNCLVIDEIDGALGDGKGAVEVILKMVSTERKADNRKGNVAKVDES--GQISSKKGHKTA 143

Query: 539 XLSRPVICICNDPYA 583
LSRPVICICND YA
Sbjct: 144 SLSRPVICICNDLYA 158


>tr|A7R3W8|A7R3W8_VITVI Chromosome undetermined scaffold_582, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004020001 PE=4 SV=1
Length = 156

Score = 131 bits (330), Expect = 2e-29
Identities = 73/135 (54%), Positives = 81/135 (60%)
Frame = +2

Query: 179 KILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLR 358
+ILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR ST++AKILD VQM SVM D +
Sbjct: 13 QILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSTIEAKILDVVQMNSVMADSK 72

Query: 359 PNCVVIDEXXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXXX 538
PNC+VIDE G V + DE+
Sbjct: 73 PNCLVIDEIDGALSDGKGAVEVILKMVSTERKADNRKGNVAKVDES--GQISSKKGHKTA 130

Query: 539 XLSRPVICICNDPYA 583
LSRPVICICND YA
Sbjct: 131 SLSRPVICICNDLYA 145


>tr|A7R4P1|A7R4P1_VITVI Chromosome undetermined scaffold_749, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004606001 PE=4 SV=1
Length = 305

Score = 129 bits (324), Expect = 1e-28
Identities = 73/136 (53%), Positives = 81/136 (59%)
Frame = +2

Query: 176 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDL 355
+KILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR S ++AKILD VQM SVM D
Sbjct: 139 QKILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSIIEAKILDVVQMNSVMADS 198

Query: 356 RPNCVVIDEXXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXX 535
+PNC+VIDE + G V + VI
Sbjct: 199 KPNCLVIDEID--------------------GALGDGKGAVEVILKMVIDMISSKKGHKT 238

Query: 536 XXLSRPVICICNDPYA 583
LSRPVICICND YA
Sbjct: 239 ASLSRPVICICNDLYA 254


>tr|A7R4I9|A7R4I9_VITVI Chromosome undetermined scaffold_702, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004446001 PE=4 SV=1
Length = 149

Score = 120 bits (300), Expect = 7e-26
Identities = 68/130 (52%), Positives = 76/130 (58%)
Frame = +2

Query: 182 ILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRP 361
ILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR ST++AKILD VQM SVM D +P
Sbjct: 9 ILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSTIKAKILDVVQMNSVMADSKP 68

Query: 362 NCVVIDEXXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDEAVIXXXXXXXXXXXXX 541
NC+VIDE A G V + +
Sbjct: 69 NCLVIDEIDGALGDGKGVVEVILKMVSAERKADNRKGNVAKGYKTT-------------S 115

Query: 542 LSRPVICICN 571
LSRPVICIC+
Sbjct: 116 LSRPVICICS 125