BP914240
Clone id YMU001_000056_F07
Library
Length 587
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000056_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGAAGGACTGGCAATTTCTCATAAGCAATTATGATTGCATCTGTTTACAAAACAATGCT
ATTACATACAAGGCCTGCACCAAATGCAGCCATGAATCAACACTAGCTCCAAAACCTCTC
AACCATGCTCAACATCAAGCACTGAAAAATTGTCCTGGAGAACAAGGTCACTCAAAATAA
TACAATGGTACATGCTGAGCTGATTTCAACTCTAGGGTTTGAACCTTCTAGGAAAAGACT
CCAAACATTGAGGGACAAAATTGACCTTACCACCTTTTCTAAGAAGAATATGTACAGTCC
AATGGGATGTTGAATTCTCCACAGGCCTGGTACCCAAAATTCAACTTGAACTTAACAGCG
GGGAATACGCCACAAAAGCTCATAAGCTTCACACATGTAAAATCCATGGTGTAATGACTC
ATATGCTTCCGTGCCAGCTGCAATGAGGCTAAGCCTCACATCCATTGCATAAAGCAGTGG
GGTGGATTAGAACACCTGCCGCAAAAAACTATGCTAAACTGCATATTTGCCACTTCAATT
AACTGGCATCAATATCAACATCCTTCAATGACCAATCATCAATATCA
■■Homology search results ■■ -
sp_hit_id Q9HE05
Definition sp|Q9HE05|UFD2_SCHPO Ubiquitin conjugation factor E4 OS=Schizosaccharomyces pombe
Align length 40
Score (bit) 31.6
E-value 3.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914240|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_F07.
(587 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9HE05|UFD2_SCHPO Ubiquitin conjugation factor E4 OS=Schizosa... 32 3.1

>sp|Q9HE05|UFD2_SCHPO Ubiquitin conjugation factor E4
OS=Schizosaccharomyces pombe GN=ufd2 PE=2 SV=1
Length = 1010

Score = 31.6 bits (70), Expect = 3.1
Identities = 11/40 (27%), Positives = 20/40 (50%)
Frame = -3

Query: 480 PLLYAMDVRLSLIAAGTEAYESLHHGFYMCEAYELLWRIP 361
P L A + + T+ Y+ + FY+CE + +W+ P
Sbjct: 670 PALMAFYIEIESTGQSTQFYDKFNIRFYICEVFRTIWKQP 709


tr_hit_id B3PEC6
Definition tr|B3PEC6|B3PEC6_CELJU Putative membrane protein OS=Cellvibrio japonicus (strain Ueda107)
Align length 63
Score (bit) 36.6
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914240|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_F07.
(587 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3PEC6|B3PEC6_CELJU Putative membrane protein OS=Cellvibrio j... 37 1.1
tr|A9USY5|A9USY5_MONBE Predicted protein (Fragment) OS=Monosiga ... 33 9.1

>tr|B3PEC6|B3PEC6_CELJU Putative membrane protein OS=Cellvibrio
japonicus (strain Ueda107) GN=CJA_3228 PE=4 SV=1
Length = 191

Score = 36.6 bits (83), Expect = 1.1
Identities = 21/63 (33%), Positives = 32/63 (50%)
Frame = -3

Query: 336 WVPGLWRIQHPIGLYIFFLEKVVRSILSLNVWSLFLEGSNPRVEISSACTIVLF*VTLFS 157
W+ W IQHP+GL + ++R++L L+VW LF + V S L + +
Sbjct: 117 WIVYSWIIQHPLGL----IHALLRTVLVLSVWLLFPDSRLTAVSFSVVLVYGLSIWQMLN 172

Query: 156 RTI 148
RTI
Sbjct: 173 RTI 175


>tr|A9USY5|A9USY5_MONBE Predicted protein (Fragment) OS=Monosiga
brevicollis GN=2316 PE=4 SV=1
Length = 241

Score = 33.5 bits (75), Expect = 9.1
Identities = 17/43 (39%), Positives = 20/43 (46%)
Frame = +1

Query: 28 NYDCICLQNNAITYKACTKCSHESTLAPKPLNHAQHQALKNCP 156
N D C A ACT C+ AP+ LN A Q + NCP
Sbjct: 50 NCDSTCATCEAAGSNACTSCT-----APRTLNAATRQCISNCP 87