BP914250
Clone id YMU001_000056_G06
Library
Length 546
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000056_G06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTTCGAACTAGACGAACAGCAGATAGAGAAGGTATCTCGGCAAAGAATGGCGTGATTGG
AGCTGAGAGTGGTTCAAAAGGCATTCAACAGACTGATATGTTTTCAAGATCAATCCATCA
ACTCCAAAGGTTCCGTCACTTCTAGTGCAAATAAACCACTAGATGACAGACTATAAGAAA
AGATTCTTCTCCTGTGTGGACCTCCAGGGCTTGGTAAAACAACTCTTGCTCATGTTGCTG
CAAGGCATTGTGGATACCGAGTTGTTGAGATAAATGCAAGTGATGATCGGGTGTTGTCAA
CCTTGCAAGCAAAAATATTGGATGCAGTTCAAATGAAATCTGTCATGGGTGATTTAAGAC
CCAATTGTGTGGTGATTGATGAAATTGATGGAGCACTTGGAGGTGCAGATGGAAAGGGTG
CGATAGATGCTCTCTTGAAAATTGCTTATGCTGGAACAAAGGAACTTTCAGGAAAGGTGA
ACGAGAAAGATGAAGCAGTGATTAAGAAGGCATCCAAAAAGAACACATCCACAACTGCGA
CACTTT
■■Homology search results ■■ -
sp_hit_id Q6NU40
Definition sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 18 homolog OS=Xenopus laevis
Align length 140
Score (bit) 96.7
E-value 7.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914250|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_G06.
(546 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 1... 97 7e-20
sp|Q8BIW9|CTF18_MOUSE Chromosome transmission fidelity protein 1... 92 2e-18
sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 1... 91 3e-18
sp|P0C1D3|CTF18_EMENI Chromosome transmission fidelity protein 1... 82 2e-15
sp|Q9USQ1|CTF18_SCHPO Chromosome transmission fidelity protein 1... 72 2e-12
sp|P49956|CTF18_YEAST Chromosome transmission fidelity protein 1... 62 1e-09
sp|O60182|RFC1_SCHPO Replication factor C subunit 1 OS=Schizosac... 57 6e-08
sp|A1RWU6|RFCL_THEPD Replication factor C large subunit OS=Therm... 57 8e-08
sp|P38630|RFC1_YEAST Replication factor C subunit 1 OS=Saccharom... 55 2e-07
sp|A4WGV3|RFCL_PYRAR Replication factor C large subunit OS=Pyrob... 55 2e-07
sp|A4FZL6|RFCL_METM5 Replication factor C large subunit OS=Metha... 55 3e-07
sp|Q58294|RFCL_METJA Replication factor C large subunit OS=Metha... 55 3e-07
sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapi... 55 3e-07
sp|Q8ZYK3|RFCL_PYRAE Replication factor C large subunit OS=Pyrob... 54 4e-07
sp|P35601|RFC1_MOUSE Replication factor C subunit 1 OS=Mus muscu... 54 5e-07
sp|Q2NH88|RFCL_METST Replication factor C large subunit OS=Metha... 53 8e-07
sp|Q6M0E9|RFCL_METMP Replication factor C large subunit OS=Metha... 53 8e-07
sp|Q5JHP1|RFCL_PYRKO Replication factor C large subunit OS=Pyroc... 53 1e-06
sp|A6VIW1|RFCL_METM7 Replication factor C large subunit OS=Metha... 53 1e-06
sp|A6URV8|RFCL_METVS Replication factor C large subunit OS=Metha... 52 1e-06
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyroc... 52 2e-06
sp|Q12TX1|RFCL_METBU Replication factor C large subunit OS=Metha... 52 2e-06
sp|O57853|RFCL_PYRHO Replication factor C large subunit OS=Pyroc... 52 2e-06
sp|A3MS27|RFCL_PYRCJ Replication factor C large subunit OS=Pyrob... 52 2e-06
sp|A5UMF4|RFCL_METS3 Replication factor C large subunit OS=Metha... 51 4e-06
sp|A1RSA3|RFCL_PYRIL Replication factor C large subunit OS=Pyrob... 50 5e-06
sp|A6UWR5|RFCL_META3 Replication factor C large subunit OS=Metha... 50 9e-06
sp|Q8TPU4|RFCL_METAC Replication factor C large subunit OS=Metha... 49 1e-05
sp|Q9UWR2|RFCL_PYRFU Replication factor C large subunit OS=Pyroc... 49 2e-05
sp|P35600|RFC1_DROME Replication factor C subunit 1 OS=Drosophil... 49 2e-05

>sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 18
homolog OS=Xenopus laevis GN=chtf18 PE=2 SV=1
Length = 1000

Score = 96.7 bits (239), Expect = 7e-20
Identities = 59/140 (42%), Positives = 75/140 (53%), Gaps = 7/140 (5%)
Frame = +3

Query: 105 QDQSINSKGSVTSS---ANKPLDDRL*EKILLLCGPPGLGKTTLAHVAARHCGYRVVEIN 275
Q +K +T A +R K+ LLCGPPGLGKTTLAHV ARH GY VVE+N
Sbjct: 362 QQSKFKTKAQITEEILEAELDHHNRPKNKVSLLCGPPGLGKTTLAHVIARHAGYNVVEMN 421

Query: 276 ASDDRVLSTLQAKILDAVQMKSVMG-DLRPNCVVIDE---XXXXXXXXXXXXXXXXXXKI 443
ASDDR + +I A QMKSV+G D RPNC++IDE K
Sbjct: 422 ASDDRSPEAFRTRIEAATQMKSVLGVDERPNCLIIDEIDGAPTVSINMLLSLVNRKDAKE 481

Query: 444 AYAGTKELSGKVNEKDEAVI 503
A GT+ +GK +K+ ++
Sbjct: 482 AEGGTEATTGKKKKKEGGLL 501


>sp|Q8BIW9|CTF18_MOUSE Chromosome transmission fidelity protein 18
homolog OS=Mus musculus GN=Chtf18 PE=2 SV=2
Length = 969

Score = 92.0 bits (227), Expect = 2e-18
Identities = 46/70 (65%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
Frame = +3

Query: 177 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMG-D 353
+K+ LLCGPPGLGKTTLAHV ARH GY VVE+NASDDR + +I A QM+SV+G
Sbjct: 362 QKVALLCGPPGLGKTTLAHVVARHAGYCVVEMNASDDRSPEAFRTRIEAATQMESVLGVG 421

Query: 354 LRPNCVVIDE 383
RPNC+VIDE
Sbjct: 422 GRPNCLVIDE 431


>sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18
homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1
Length = 975

Score = 91.3 bits (225), Expect = 3e-18
Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
Frame = +3

Query: 177 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMG-D 353
+K+ LLCGPPGLGKTTLAHV ARH GY VVE+NASDDR + +I A QM+SV+G
Sbjct: 367 QKVALLCGPPGLGKTTLAHVIARHAGYSVVEMNASDDRSPEVFRTRIEAATQMESVLGAG 426

Query: 354 LRPNCVVIDE 383
+PNC+VIDE
Sbjct: 427 GKPNCLVIDE 436


>sp|P0C1D3|CTF18_EMENI Chromosome transmission fidelity protein 18
OS=Emericella nidulans GN=ctf18 PE=3 SV=1
Length = 993

Score = 81.6 bits (200), Expect = 2e-15
Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 12/90 (13%)
Frame = +3

Query: 150 NKPLDDRL*EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAV 329
N ++R K+LLLCGPPGLGKTTLAHV AR GY V+EINASD+R ++ +I DA+
Sbjct: 305 NNDEEERPHRKVLLLCGPPGLGKTTLAHVCARQAGYEVLEINASDERSRDVVKGRIRDAL 364

Query: 330 QMKSVMG---DL---------RPNCVVIDE 383
++V G +L RP CVV+DE
Sbjct: 365 GTENVKGMNVELGEQKVRKVGRPVCVVVDE 394


>sp|Q9USQ1|CTF18_SCHPO Chromosome transmission fidelity protein 18
OS=Schizosaccharomyces pombe GN=ctf18 PE=1 SV=1
Length = 960

Score = 71.6 bits (174), Expect = 2e-12
Identities = 35/73 (47%), Positives = 48/73 (65%)
Frame = +3

Query: 165 DRL*EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSV 344
DR ++I++L G G GKTTLAHV A GY+V+EINASDDR T+ K+ A+ S
Sbjct: 412 DRPDKRIMMLTGLAGAGKTTLAHVIAHQAGYKVLEINASDDRTAHTVHEKVSSAISNHSA 471

Query: 345 MGDLRPNCVVIDE 383
+ +P CV++DE
Sbjct: 472 LSS-QPTCVIVDE 483


>sp|P49956|CTF18_YEAST Chromosome transmission fidelity protein 18
OS=Saccharomyces cerevisiae GN=CTF18 PE=1 SV=1
Length = 741

Score = 62.4 bits (150), Expect = 1e-09
Identities = 39/106 (36%), Positives = 56/106 (52%)
Frame = +3

Query: 177 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDL 356
+KILLL GPPG+GKT++AHV A+ G+ V EINASD+R ++ KI + + + D
Sbjct: 176 KKILLLHGPPGIGKTSVAHVIAKQSGFSVSEINASDERAGPMVKEKIYNLLFNHTF--DT 233

Query: 357 RPNCVVIDEXXXXXXXXXXXXXXXXXXKIAYAGTKELSGKVNEKDE 494
P C+V DE A K L G+ ++KD+
Sbjct: 234 NPVCLVADEIDGSIESGFIRILVDIMQSDIKATNKLLYGQPDKKDK 279


>sp|O60182|RFC1_SCHPO Replication factor C subunit 1
OS=Schizosaccharomyces pombe GN=rfc1 PE=1 SV=1
Length = 934

Score = 57.0 bits (136), Expect = 6e-08
Identities = 41/95 (43%), Positives = 52/95 (54%), Gaps = 1/95 (1%)
Frame = +3

Query: 69 VVQKAFNRLICFQDQSINSKGSVTSSANKPLDDRL*-EKILLLCGPPGLGKTTLAHVAAR 245
VVQK L QD N K S+ NKP D L K +LL GPPG+GKTT AH+ A+
Sbjct: 379 VVQKLQKWL---QDYHKNRK----SNFNKPGPDGLGLYKAVLLSGPPGIGKTTAAHLVAK 431

Query: 246 HCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMG 350
GY V+E+NASD R L ++ +S+ G
Sbjct: 432 LEGYDVLELNASDTRSKRLLDEQLFGVTDSQSLAG 466


>sp|A1RWU6|RFCL_THEPD Replication factor C large subunit
OS=Thermofilum pendens (strain Hrk 5) GN=rfcL PE=3 SV=1
Length = 413

Score = 56.6 bits (135), Expect = 8e-08
Identities = 25/58 (43%), Positives = 38/58 (65%)
Frame = +3

Query: 177 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMG 350
+K LL GPPG GKT++ H A+ + ++E+NASD R LQ ++L A+ +SV+G
Sbjct: 47 KKAALLYGPPGSGKTSIVHATAKEFSWELIELNASDVRTREALQQRLLGALNTRSVLG 104


>sp|P38630|RFC1_YEAST Replication factor C subunit 1
OS=Saccharomyces cerevisiae GN=RFC1 PE=1 SV=1
Length = 861

Score = 55.5 bits (132), Expect = 2e-07
Identities = 27/59 (45%), Positives = 39/59 (66%)
Frame = +3

Query: 189 LLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRPN 365
+L GPPG+GKTT AH+ A+ GY ++E NASD R + L A + +A+ SV+G + N
Sbjct: 350 MLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHN 408


>sp|A4WGV3|RFCL_PYRAR Replication factor C large subunit
OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM
11321) GN=rfcL PE=3 SV=1
Length = 422

Score = 55.1 bits (131), Expect = 2e-07
Identities = 30/75 (40%), Positives = 42/75 (56%)
Frame = +3

Query: 126 KGSVTSSANKPLDDRL*EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTL 305
K T A K + L + +LL GPPG+GKTTL H AR GY ++E+NASD R L
Sbjct: 39 KDFCTRWAKKKDKEILDARAVLLAGPPGVGKTTLIHALAREIGYELIELNASDVRTAERL 98

Query: 306 QAKILDAVQMKSVMG 350
+ + ++ S+ G
Sbjct: 99 KEVVGRGLREGSLFG 113


tr_hit_id A9RCL3
Definition tr|A9RCL3|A9RCL3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 139
Score (bit) 139.0
E-value 7.0e-32
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914250|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_G06.
(546 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RCL3|A9RCL3_PHYPA Predicted protein OS=Physcomitrella paten... 139 7e-32
tr|A5CB86|A5CB86_VITVI Putative uncharacterized protein OS=Vitis... 120 5e-26
tr|A7R4P1|A7R4P1_VITVI Chromosome undetermined scaffold_749, who... 119 1e-25
tr|A7R3W8|A7R3W8_VITVI Chromosome undetermined scaffold_582, who... 119 1e-25
tr|A7R600|A7R600_VITVI Chromosome undetermined scaffold_1105, wh... 118 2e-25
tr|A7R4I9|A7R4I9_VITVI Chromosome undetermined scaffold_702, who... 118 2e-25
tr|Q84QB4|Q84QB4_ORYSJ Putative uncharacterized protein OJ1012B0... 116 9e-25
tr|Q10NN1|Q10NN1_ORYSJ ATPase, AAA family protein, expressed OS=... 116 9e-25
tr|Q0DT80|Q0DT80_ORYSJ Os03g0264800 protein OS=Oryza sativa subs... 116 9e-25
tr|B8AKQ6|B8AKQ6_ORYSI Putative uncharacterized protein OS=Oryza... 116 9e-25
tr|A7R3A1|A7R3A1_VITVI Chromosome undetermined scaffold_496, who... 116 9e-25
tr|A3AGC1|A3AGC1_ORYSJ Putative uncharacterized protein OS=Oryza... 116 9e-25
tr|A7R4C5|A7R4C5_VITVI Chromosome undetermined scaffold_649, who... 114 3e-24
tr|A7R7D0|A7R7D0_VITVI Chromosome undetermined scaffold_1704, wh... 112 1e-23
tr|A7R624|A7R624_VITVI Chromosome undetermined scaffold_1134, wh... 112 1e-23
tr|A8ISE0|A8ISE0_CHLRE DNA damage repair and chromosome cohesion... 105 1e-21
tr|A4S9K8|A4S9K8_OSTLU Predicted protein (Fragment) OS=Ostreococ... 100 5e-20
tr|A5AY69|A5AY69_VITVI Putative uncharacterized protein OS=Vitis... 99 1e-19
tr|B6LD88|B6LD88_BRAFL Putative uncharacterized protein OS=Branc... 97 7e-19
tr|A7RJV2|A7RJV2_NEMVE Predicted protein (Fragment) OS=Nematoste... 96 1e-18
tr|Q5ZHX0|Q5ZHX0_CHICK Putative uncharacterized protein (Fragmen... 95 2e-18
tr|O23012|O23012_ARATH T1G11.2 protein OS=Arabidopsis thaliana G... 94 6e-18
tr|B3RMJ4|B3RMJ4_TRIAD Putative uncharacterized protein OS=Trich... 92 2e-17
tr|Q16Z43|Q16Z43_AEDAE Putative uncharacterized protein OS=Aedes... 92 2e-17
tr|Q16Z42|Q16Z42_AEDAE Putative uncharacterized protein OS=Aedes... 92 2e-17
tr|Q96S08|Q96S08_HUMAN Protein CTF18 homolog. OS=Homo sapiens GN... 91 3e-17
tr|Q7Z6Y4|Q7Z6Y4_HUMAN CTF18, chromosome transmission fidelity f... 91 3e-17
tr|B7ZBA2|B7ZBA2_HUMAN CTF18, chromosome transmission fidelity f... 91 3e-17
tr|Q4T303|Q4T303_TETNG Chromosome 18 SCAF10147, whole genome sho... 91 4e-17
tr|A9UUS9|A9UUS9_MONBE Predicted protein (Fragment) OS=Monosiga ... 90 7e-17

>tr|A9RCL3|A9RCL3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64140 PE=4 SV=1
Length = 1081

Score = 139 bits (351), Expect = 7e-32
Identities = 76/139 (54%), Positives = 90/139 (64%), Gaps = 1/139 (0%)
Frame = +3

Query: 87 NRLICFQDQSINSKGS-VTSSANKPLDDRL*EKILLLCGPPGLGKTTLAHVAARHCGYRV 263
N+ + +++ + NS + ++ K DR EK+LLLCGPPGLGKTTLAHVAARHCGYRV
Sbjct: 433 NKSMAYRNDTFNSDSTRKVATEEKSTLDRPEEKVLLLCGPPGLGKTTLAHVAARHCGYRV 492

Query: 264 VEINASDDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDEXXXXXXXXXXXXXXXXXXKI 443
VEINASDDRV +TLQ KILDA+QMKSV GD RPNC+VIDE +I
Sbjct: 493 VEINASDDRVATTLQGKILDAIQMKSVTGDNRPNCLVIDEIDGALSGAEGKGAIDSLLEI 552

Query: 444 AYAGTKELSGKVNEKDEAV 500
A K GK NE E V
Sbjct: 553 INADKKSSLGKENEMQEGV 571


>tr|A5CB86|A5CB86_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003510 PE=4 SV=1
Length = 169

Score = 120 bits (301), Expect = 5e-26
Identities = 57/68 (83%), Positives = 62/68 (91%)
Frame = +3

Query: 180 KILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLR 359
KILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR ST++AKILD VQM SVM D +
Sbjct: 26 KILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSTIEAKILDVVQMNSVMADSK 85

Query: 360 PNCVVIDE 383
PNC+VIDE
Sbjct: 86 PNCLVIDE 93


>tr|A7R4P1|A7R4P1_VITVI Chromosome undetermined scaffold_749, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004606001 PE=4 SV=1
Length = 305

Score = 119 bits (297), Expect = 1e-25
Identities = 56/69 (81%), Positives = 62/69 (89%)
Frame = +3

Query: 177 EKILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDL 356
+KILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR S ++AKILD VQM SVM D
Sbjct: 139 QKILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSIIEAKILDVVQMNSVMADS 198

Query: 357 RPNCVVIDE 383
+PNC+VIDE
Sbjct: 199 KPNCLVIDE 207


>tr|A7R3W8|A7R3W8_VITVI Chromosome undetermined scaffold_582, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004020001 PE=4 SV=1
Length = 156

Score = 119 bits (297), Expect = 1e-25
Identities = 56/68 (82%), Positives = 62/68 (91%)
Frame = +3

Query: 180 KILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLR 359
+ILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR ST++AKILD VQM SVM D +
Sbjct: 13 QILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSTIEAKILDVVQMNSVMADSK 72

Query: 360 PNCVVIDE 383
PNC+VIDE
Sbjct: 73 PNCLVIDE 80


>tr|A7R600|A7R600_VITVI Chromosome undetermined scaffold_1105, whole
genome shotgun sequence (Fragment) OS=Vitis vinifera
GN=GSVIVT00007866001 PE=4 SV=1
Length = 319

Score = 118 bits (296), Expect = 2e-25
Identities = 56/67 (83%), Positives = 61/67 (91%)
Frame = +3

Query: 183 ILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRP 362
ILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR ST++AKILD VQM SVM D +P
Sbjct: 1 ILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSTIEAKILDVVQMNSVMADSKP 60

Query: 363 NCVVIDE 383
NC+VIDE
Sbjct: 61 NCLVIDE 67


>tr|A7R4I9|A7R4I9_VITVI Chromosome undetermined scaffold_702, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004446001 PE=4 SV=1
Length = 149

Score = 118 bits (295), Expect = 2e-25
Identities = 56/67 (83%), Positives = 61/67 (91%)
Frame = +3

Query: 183 ILLLCGPPGLGKTTLAHVAARHCGYRVVEINASDDRVLSTLQAKILDAVQMKSVMGDLRP 362
ILLLCGPPGLGKTTLAHVAA+HCGYRVVEINASDDR ST++AKILD VQM SVM D +P
Sbjct: 9 ILLLCGPPGLGKTTLAHVAAKHCGYRVVEINASDDRSSSTIKAKILDVVQMNSVMADSKP 68

Query: 363 NCVVIDE 383
NC+VIDE
Sbjct: 69 NCLVIDE 75


>tr|Q84QB4|Q84QB4_ORYSJ Putative uncharacterized protein OJ1012B02.7
OS=Oryza sativa subsp. japonica GN=OJ1012B02.7 PE=4 SV=1
Length = 973

Score = 116 bits (290), Expect = 9e-25
Identities = 61/94 (64%), Positives = 72/94 (76%), Gaps = 6/94 (6%)
Frame = +3

Query: 120 NSKGS----VTSSANK-PLDDRL*E-KILLLCGPPGLGKTTLAHVAARHCGYRVVEINAS 281
N+ GS +TSS NK P D E K+LLLCGPPGLGKTTLAHVAA+HCGY VVEINAS
Sbjct: 330 NAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGLGKTTLAHVAAKHCGYHVVEINAS 389

Query: 282 DDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDE 383
DDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 390 DDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE 423


>tr|Q10NN1|Q10NN1_ORYSJ ATPase, AAA family protein, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os03g15810 PE=4
SV=1
Length = 1002

Score = 116 bits (290), Expect = 9e-25
Identities = 61/94 (64%), Positives = 72/94 (76%), Gaps = 6/94 (6%)
Frame = +3

Query: 120 NSKGS----VTSSANK-PLDDRL*E-KILLLCGPPGLGKTTLAHVAARHCGYRVVEINAS 281
N+ GS +TSS NK P D E K+LLLCGPPGLGKTTLAHVAA+HCGY VVEINAS
Sbjct: 330 NAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGLGKTTLAHVAAKHCGYHVVEINAS 389

Query: 282 DDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDE 383
DDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 390 DDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE 423


>tr|Q0DT80|Q0DT80_ORYSJ Os03g0264800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0264800 PE=4 SV=1
Length = 973

Score = 116 bits (290), Expect = 9e-25
Identities = 61/94 (64%), Positives = 72/94 (76%), Gaps = 6/94 (6%)
Frame = +3

Query: 120 NSKGS----VTSSANK-PLDDRL*E-KILLLCGPPGLGKTTLAHVAARHCGYRVVEINAS 281
N+ GS +TSS NK P D E K+LLLCGPPGLGKTTLAHVAA+HCGY VVEINAS
Sbjct: 330 NAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGLGKTTLAHVAAKHCGYHVVEINAS 389

Query: 282 DDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDE 383
DDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 390 DDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE 423


>tr|B8AKQ6|B8AKQ6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10859 PE=4 SV=1
Length = 897

Score = 116 bits (290), Expect = 9e-25
Identities = 61/94 (64%), Positives = 72/94 (76%), Gaps = 6/94 (6%)
Frame = +3

Query: 120 NSKGS----VTSSANK-PLDDRL*E-KILLLCGPPGLGKTTLAHVAARHCGYRVVEINAS 281
N+ GS +TSS NK P D E K+LLLCGPPGLGKTTLAHVAA+HCGY VVEINAS
Sbjct: 270 NAHGSNSEDLTSSFNKRPTTDNAPEQKVLLLCGPPGLGKTTLAHVAAKHCGYHVVEINAS 329

Query: 282 DDRVLSTLQAKILDAVQMKSVMGDLRPNCVVIDE 383
DDR S+++ KILD +QM S+M D +P C+VIDE
Sbjct: 330 DDRSASSIEPKILDVIQMNSIMSDSKPKCLVIDE 363