BP914259
Clone id YMU001_000056_H03
Library
Length 512
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000056_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TAAGGTGCTATTGAAGAAGGCCAAGGCCTCTACCACCTTGATCTGGTCGTGGAACAAGGC
TCTACAGCGATGAGTTTTTTGATACGTTCAATACATTTTTGATTCAATTACATACATAGT
TACCTTTCTGGTCTTGATACAGAGGAGGTGTAACTATGTGCAGAGAATGAAGATTTGGAT
ATATTTCAGTTTCTTGCCAATCTTACCATTGATGCAGACGAGGAGAAGGGGTTTGTCTGC
GATCATTACAGTTTTGCAATTGAACCATGGCATAGATTTGGCCAGCCGCAATCTTGTTCA
AGCAGCATGTTATGTGGAGAGGAGCTGCCACCCCTGCATCCAGCTTTTTGTAGCTCTTGC
ATTGGTGGTCCCTAAAGTAGGCCACTGCGGAATGTGCAGTCTGATCGGTCTTTAAAAGTG
ATGTAGACTAATTGTTTTACATTGGTGAGCCACAAACGGCGAATCAGAAGAGCTTTGACC
ATTGACCATTGTACCTTAAGAGTGGGGGGCAA
■■Homology search results ■■ -
sp_hit_id Q6FY76
Definition sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata
Align length 33
Score (bit) 31.2
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914259|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_H03.
(512 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata... 31 2.9
sp|Q03SK6|UNG_LACBA Uracil-DNA glycosylase OS=Lactobacillus brev... 31 3.8
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schi... 30 5.0
sp|Q75DK9|MRT4_ASHGO mRNA turnover protein 4 homolog OS=Ashbya g... 30 6.5

>sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata
GN=RAD5 PE=3 SV=1
Length = 1151

Score = 31.2 bits (69), Expect = 2.9
Identities = 14/33 (42%), Positives = 23/33 (69%)
Frame = -1

Query: 476 KALLIRRLWLTNVKQLVYITFKDRSDCTFRSGL 378
K ++I +L L+ ++L+Y F R++ TFRSGL
Sbjct: 768 KEIVIEKLQLSKKQKLIYEEFLQRAEKTFRSGL 800


>sp|Q03SK6|UNG_LACBA Uracil-DNA glycosylase OS=Lactobacillus brevis
(strain ATCC 367 / JCM 1170) GN=ung PE=3 SV=1
Length = 239

Score = 30.8 bits (68), Expect = 3.8
Identities = 12/24 (50%), Positives = 16/24 (66%)
Frame = +1

Query: 262 EPWHRFGQPQSCSSSMLCGEELPP 333
+P+H GQ CS S+L G E+PP
Sbjct: 65 DPYHNPGQAHGCSFSVLPGTEIPP 88


>sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13
OS=Schizosaccharomyces pombe GN=SPCC4B3.13 PE=2 SV=1
Length = 539

Score = 30.4 bits (67), Expect = 5.0
Identities = 19/47 (40%), Positives = 26/47 (55%)
Frame = +2

Query: 56 KALQR*VF*YVQYIFDSITYIVTFLVLIQRRCNYVQRMKIWIYFSFL 196
+AL+R F VQ IF +TYI+ +V I NY+ W+ F FL
Sbjct: 234 EALKR--FLQVQGIFHPVTYILAIVVPINIFLNYLFVWSPWVGFGFL 278


>sp|Q75DK9|MRT4_ASHGO mRNA turnover protein 4 homolog OS=Ashbya
gossypii GN=MRT4 PE=3 SV=1
Length = 236

Score = 30.0 bits (66), Expect = 6.5
Identities = 18/50 (36%), Positives = 28/50 (56%)
Frame = -2

Query: 418 LLKTDQTAHSAVAYFRDHQCKSYKKLDAGVAAPLHITCCLNKIAAGQIYA 269
LL TD+T + AYFR+++ Y + A APL + +I AG +Y+
Sbjct: 102 LLFTDETPETVTAYFREYRKADYSR--AKSRAPLRV-----EIPAGVVYS 144


tr_hit_id A6RGC5
Definition tr|A6RGC5|A6RGC5_AJECN Putative uncharacterized protein OS=Ajellomyces capsulata (strain NAm1 / WU24)
Align length 110
Score (bit) 35.0
E-value 2.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914259|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_H03.
(512 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6RGC5|A6RGC5_AJECN Putative uncharacterized protein OS=Ajell... 35 2.1

>tr|A6RGC5|A6RGC5_AJECN Putative uncharacterized protein
OS=Ajellomyces capsulata (strain NAm1 / WU24)
GN=HCAG_08691 PE=4 SV=1
Length = 1290

Score = 35.0 bits (79), Expect = 2.1
Identities = 25/110 (22%), Positives = 52/110 (47%), Gaps = 5/110 (4%)
Frame = -2

Query: 427 STSLLKTDQTAHSAVAYFRDHQCKSYKKLDAGVAAPLHITCCLNKIAAGQIYAMVQLQNC 248
S L T++ + ++A F+D Q +Y L AG+ PL+ + K+ G+ Y +++ +
Sbjct: 203 SLVLTSTNRQSMVSIASFQDPQLATYADLAAGI--PLNSIVAVYKLDDGRPYFSIEVCHM 260

Query: 247 NDRRQTPSPRLHQW*DWQETEIY-----PNLHSLHIVTPPLYQDQKGNYV 113
++R P Q+ D +E+ ++ + PP++ + YV
Sbjct: 261 DERSPKPLSFQLQFSDPEESGLWLAGIRAAAEQARAIDPPMFDQKSVEYV 310