BP914265
Clone id YMU001_000056_H11
Library
Length 531
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000056_H11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTCGAAGAGGGGTATGCATATTTCCAAGAGATGGAGAATAGTGGGTGTGAACCGAATGCA
GTAACCTTCAATACCTTGATACATGCGTTCGCGAAAGCGGGTATGGCAGAGCTTACAAAT
AAGCTAATGAACGAAATGGAAGCTAGAGGTTGTGGGCCTGATCCATACACCTACAGTAGT
CTGATTGATGGGCTGGGCAGGTCGGGCTCAGTTCAAACAGCTATAGAGGTTTTCAACCAA
TTGAAAGTCTTGGGCACATGCCTGACTGTGGCTGTGTGTAATTCCATCATATGCGTACTA
GTAAGAGACAACAGGATAGACGATGCTTTGGACTGTTTCAATGAAATGCCTCAGTTTGGG
TGCTCCCCTGATGATTGGACATTCCGAGCCCTTTGTTTTGGCCTCAAGAATGCAAAAAGA
TTTGAGGAAGCACTGAAGCTCGAGCAGCTTCAGCAGCTTTCTGCCTCTAAACGGATTCAC
TTTAACAAATTTTAAGGGATGTGTTATTGAATAAAAAAAAACAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q9FMF6
Definition sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana
Align length 136
Score (bit) 92.8
E-value 8.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914265|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_H11.
(509 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protei... 93 8e-19
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protei... 90 5e-18
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein... 86 1e-16
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containi... 86 1e-16
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protei... 85 2e-16
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protei... 85 2e-16
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protei... 84 4e-16
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protei... 83 7e-16
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protei... 83 7e-16
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protei... 83 9e-16
sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containi... 82 1e-15
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protei... 82 2e-15
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protei... 81 2e-15
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protei... 81 3e-15
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protei... 81 3e-15
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protei... 79 1e-14
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containi... 79 1e-14
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protei... 79 2e-14
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protei... 79 2e-14
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protei... 79 2e-14
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protei... 79 2e-14
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protei... 78 2e-14
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containi... 78 3e-14
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protei... 77 4e-14
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protei... 77 4e-14
sp|Q9SFV9|PP218_ARATH Pentatricopeptide repeat-containing protei... 77 5e-14
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protei... 77 5e-14

>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein
At5g64320, mitochondrial OS=Arabidopsis thaliana
GN=At5g64320 PE=2 SV=1
Length = 730

Score = 92.8 bits (229), Expect = 8e-19
Identities = 45/136 (33%), Positives = 78/136 (57%), Gaps = 1/136 (0%)
Frame = +1

Query: 1 LEEGYAYFQEMENS-GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYS 177
L++ A +M S G P+ T+N+LI+ + K G+ L +++++M +GC P+ Y+Y+
Sbjct: 369 LDDAKAVLSDMVTSYGIVPDVCTYNSLIYGYWKEGLVGLALEVLHDMRNKGCKPNVYSYT 428

Query: 178 SLIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQF 357
L+DG + G + A V N++ G N +I +++RI +A++ F EMP+
Sbjct: 429 ILVDGFCKLGKIDEAYNVLNEMSADGLKPNTVGFNCLISAFCKEHRIPEAVEIFREMPRK 488

Query: 358 GCSPDDWTFRALCFGL 405
GC PD +TF +L GL
Sbjct: 489 GCKPDVYTFNSLISGL 504



Score = 81.3 bits (199), Expect = 2e-15
Identities = 50/132 (37%), Positives = 73/132 (55%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
++M + G N VT+NTLI+AF + G + KL+NEM +G D TY+SLI GL R+
Sbjct: 518 RDMISEGVVANTVTYNTLINAFLRRGEIKEARKLVNEMVFQGSPLDEITYNSLIKGLCRA 577

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
G V A +F ++ G + CN +I L R +++A++ EM G +PD TF
Sbjct: 578 GEVDKARSLFEKMLRDGHAPSNISCNILINGLCRSGMVEEAVEFQKEMVLRGSTPDIVTF 637

Query: 385 RALCFGLKNAKR 420
+L GL A R
Sbjct: 638 NSLINGLCRAGR 649



Score = 76.3 bits (186), Expect = 8e-14
Identities = 45/138 (32%), Positives = 65/138 (47%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E Y EM G +PN V FN LI AF K ++ EM +GC PD YT++S
Sbjct: 440 IDEAYNVLNEMSADGLKPNTVGFNCLISAFCKEHRIPEAVEIFREMPRKGCKPDVYTFNS 499

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI GL ++ A+ + + G N++I +R I +A NEM G
Sbjct: 500 LISGLCEVDEIKHALWLLRDMISEGVVANTVTYNTLINAFLRRGEIKEARKLVNEMVFQG 559

Query: 361 CSPDDWTFRALCFGLKNA 414
D+ T+ +L GL A
Sbjct: 560 SPLDEITYNSLIKGLCRA 577



Score = 62.4 bits (150), Expect = 1e-09
Identities = 36/134 (26%), Positives = 64/134 (47%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++ + ++M GC PN+V + TLIH+ +K +L+ EM GC PD T++
Sbjct: 233 IDSALSLLRDMTKHGCVPNSVIYQTLIHSLSKCNRVNEALQLLEEMFLMGCVPDAETFND 292

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+I GL + + A ++ N++ + G ++ L + R+D A D F +P+
Sbjct: 293 VILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAKDLFYRIPK-- 350

Query: 361 CSPDDWTFRALCFG 402
P+ F L G
Sbjct: 351 --PEIVIFNTLIHG 362



Score = 62.4 bits (150), Expect = 1e-09
Identities = 36/131 (27%), Positives = 68/131 (51%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ + F++M G P+ ++ N LI+ ++GM E + EM RG PD T++S
Sbjct: 580 VDKARSLFEKMLRDGHAPSNISCNILINGLCRSGMVEEAVEFQKEMVLRGSTPDIVTFNS 639

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+GL R+G ++ + +F +L+ G N+++ L + + DA +E + G
Sbjct: 640 LINGLCRAGRIEDGLTMFRKLQAEGIPPDTVTFNTLMSWLCKGGFVYDACLLLDEGIEDG 699

Query: 361 CSPDDWTFRAL 393
P+ T+ L
Sbjct: 700 FVPNHRTWSIL 710



Score = 49.7 bits (117), Expect = 8e-06
Identities = 29/127 (22%), Positives = 55/127 (43%), Gaps = 1/127 (0%)
Frame = +1

Query: 28 EMENS-GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
EM N CEP ++N ++ ++ + +M +R P +T+ ++
Sbjct: 171 EMRNVYSCEPTFKSYNVVLEILVSGNCHKVAANVFYDMLSRKIPPTLFTFGVVMKAFCAV 230

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
+ +A+ + + G + ++I L + NR+++AL EM GC PD TF
Sbjct: 231 NEIDSALSLLRDMTKHGCVPNSVIYQTLIHSLSKCNRVNEALQLLEEMFLMGCVPDAETF 290

Query: 385 RALCFGL 405
+ GL
Sbjct: 291 NDVILGL 297



Score = 38.1 bits (87), Expect = 0.024
Identities = 20/65 (30%), Positives = 34/65 (52%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E+G F++++ G P+ VTFNTL+ K G L++E G P+ T+S
Sbjct: 650 IEDGLTMFRKLQAEGIPPDTVTFNTLMSWLCKGGFVYDACLLLDEGIEDGFVPNHRTWSI 709

Query: 181 LIDGL 195
L+ +
Sbjct: 710 LLQSI 714


>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein
At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1
Length = 598

Score = 90.1 bits (222), Expect = 5e-18
Identities = 47/135 (34%), Positives = 72/135 (53%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E+ ++ + GC P +T+NT+I AKAG KL++EM A+ PD TYSS
Sbjct: 430 VEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSS 489

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L+ GL R G V AI+ F++ + +G NSI+ L + + D A+D M G
Sbjct: 490 LVGGLSREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKSRQTDRAIDFLVFMINRG 549

Query: 361 CSPDDWTFRALCFGL 405
C P++ ++ L GL
Sbjct: 550 CKPNETSYTILIEGL 564



Score = 88.6 bits (218), Expect = 2e-17
Identities = 39/140 (27%), Positives = 81/140 (57%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++ Y + M + GC P+ VT+NT++ A K G E +++N++ ++GC P TY++
Sbjct: 395 MDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYNT 454

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+IDGL ++G AI++ ++++ +S++ L R+ ++D+A+ F+E + G
Sbjct: 455 VIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAIKFFHEFERMG 514

Query: 361 CSPDDWTFRALCFGLKNAKR 420
P+ TF ++ GL +++
Sbjct: 515 IRPNAVTFNSIMLGLCKSRQ 534



Score = 80.5 bits (197), Expect = 4e-15
Identities = 39/127 (30%), Positives = 68/127 (53%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
++M GC+PN++++N L+H F K + + + M +RGC PD TY++++ L +
Sbjct: 368 EKMPQHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKD 427

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
G V+ A+E+ NQL G + N++I L + + A+ +EM PD T+
Sbjct: 428 GKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITY 487

Query: 385 RALCFGL 405
+L GL
Sbjct: 488 SSLVGGL 494



Score = 73.6 bits (179), Expect = 5e-13
Identities = 37/131 (28%), Positives = 65/131 (49%)
Frame = +1

Query: 28 EMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSG 207
EM + GC P+ VT+N L++ K G + K +N+M + GC P+ T++ ++ + +G
Sbjct: 264 EMRDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMCSTG 323

Query: 208 SVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFR 387
A ++ + G +V N +I L R + A+D +MPQ GC P+ ++
Sbjct: 324 RWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGCQPNSLSYN 383

Query: 388 ALCFGLKNAKR 420
L G K+
Sbjct: 384 PLLHGFCKEKK 394



Score = 71.6 bits (174), Expect = 2e-12
Identities = 35/129 (27%), Positives = 65/129 (50%)
Frame = +1

Query: 28 EMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSG 207
+M G P+ VTFN LI+ + G+ ++ +M GC P+ +Y+ L+ G +
Sbjct: 334 DMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGCQPNSLSYNPLLHGFCKEK 393

Query: 208 SVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFR 387
+ AIE ++ G + N+++ L +D +++DA++ N++ GCSP T+
Sbjct: 394 KMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYN 453

Query: 388 ALCFGLKNA 414
+ GL A
Sbjct: 454 TVIDGLAKA 462



Score = 68.6 bits (166), Expect = 2e-11
Identities = 33/126 (26%), Positives = 67/126 (53%), Gaps = 4/126 (3%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
++ P+ VT+NT++ + +G + ++++ M R C PD TY+ LI+ R
Sbjct: 195 LDRMSVSPDVVTYNTILRSLCDSGKLKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSG 254

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT--- 381
V A+++ ++++ G V N ++ + ++ R+D+A+ N+MP GC P+ T
Sbjct: 255 VGHAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNI 314

Query: 382 -FRALC 396
R++C
Sbjct: 315 ILRSMC 320



Score = 67.0 bits (162), Expect = 5e-11
Identities = 37/131 (28%), Positives = 64/131 (48%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEEG+ + + M G P+ + TLI F + G K++ +E G PD TY+
Sbjct: 118 LEEGFKFLENMVYHGNVPDIIPCTTLIRGFCRLGKTRKAAKILEILEGSGAVPDVITYNV 177

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+I G ++G + A+ V +++ V +T N+I+ L ++ A++ + M Q
Sbjct: 178 MISGYCKAGEINNALSVLDRMSVSPDVVTY---NTILRSLCDSGKLKQAMEVLDRMLQRD 234

Query: 361 CSPDDWTFRAL 393
C PD T+ L
Sbjct: 235 CYPDVITYTIL 245



Score = 63.5 bits (153), Expect = 5e-10
Identities = 37/125 (29%), Positives = 65/125 (52%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
+E SG P+ +T+N +I + KAG E+ N L + ++ PD TY++++ L SG
Sbjct: 163 LEGSGAVPDVITYNVMISGYCKAG--EINNAL-SVLDRMSVSPDVVTYNTILRSLCDSGK 219

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
++ A+EV +++ V +I RD+ + A+ +EM GC+PD T+
Sbjct: 220 LKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVTYNV 279

Query: 391 LCFGL 405
L G+
Sbjct: 280 LVNGI 284



Score = 58.9 bits (141), Expect = 1e-08
Identities = 28/81 (34%), Positives = 45/81 (55%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E +F E E G PNAVTFN+++ K+ + + M RGC P+ +Y+
Sbjct: 500 VDEAIKFFHEFERMGIRPNAVTFNSIMLGLCKSRQTDRAIDFLVFMINRGCKPNETSYTI 559

Query: 181 LIDGLGRSGSVQTAIEVFNQL 243
LI+GL G + A+E+ N+L
Sbjct: 560 LIEGLAYEGMAKEALELLNEL 580



Score = 35.0 bits (79), Expect = 0.20
Identities = 16/40 (40%), Positives = 24/40 (60%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARG 150
M N GC+PN ++ LI A GMA+ +L+NE+ +G
Sbjct: 545 MINRGCKPNETSYTILIEGLAYEGMAKEALELLNELCNKG 584


>sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein
At1g03560, mitochondrial OS=Arabidopsis thaliana
GN=At1g03560 PE=2 SV=1
Length = 660

Score = 85.9 bits (211), Expect = 1e-16
Identities = 44/131 (33%), Positives = 72/131 (54%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L EGY F+ M G +PN + LI +AK+G E +L++ M G PD TYS
Sbjct: 343 LNEGYTVFENMIRKGSKPNVAIYTVLIDGYAKSGSVEDAIRLLHRMIDEGFKPDVVTYSV 402

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+++GL ++G V+ A++ F+ + G + +S+I L + R+D+A F EM + G
Sbjct: 403 VVNGLCKNGRVEEALDYFHTCRFDGLAINSMFYSSLIDGLGKAGRVDEAERLFEEMSEKG 462

Query: 361 CSPDDWTFRAL 393
C+ D + + AL
Sbjct: 463 CTRDSYCYNAL 473



Score = 56.6 bits (135), Expect = 7e-08
Identities = 37/135 (27%), Positives = 65/135 (48%)
Frame = +1

Query: 16 AYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGL 195
A +QEM+ G + F+ +I K G + M +G P+ Y+ LIDG
Sbjct: 313 ALYQEMDEKGIQVPPHAFSLVIGGLCKEGKLNEGYTVFENMIRKGSKPNVAIYTVLIDGY 372

Query: 196 GRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDD 375
+SGSV+ AI + +++ G V + ++ L ++ R+++ALD F+ G + +
Sbjct: 373 AKSGSVEDAIRLLHRMIDEGFKPDVVTYSVVVNGLCKNGRVEEALDYFHTCRFDGLAINS 432

Query: 376 WTFRALCFGLKNAKR 420
+ +L GL A R
Sbjct: 433 MFYSSLIDGLGKAGR 447



Score = 55.1 bits (131), Expect = 2e-07
Identities = 29/127 (22%), Positives = 60/127 (47%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+ ME+ +P+ VT+NT+I + KAG + + + +ME RG D TY ++I
Sbjct: 245 FEVMESGRIKPDIVTYNTMIKGYCKAGQTQKAMEKLRDMETRGHEADKITYMTMIQACYA 304

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
+ + ++ ++ G + + +I L ++ ++++ F M + G P+
Sbjct: 305 DSDFGSCVALYQEMDEKGIQVPPHAFSLVIGGLCKEGKLNEGYTVFENMIRKGSKPNVAI 364

Query: 382 FRALCFG 402
+ L G
Sbjct: 365 YTVLIDG 371



Score = 49.7 bits (117), Expect = 8e-06
Identities = 31/135 (22%), Positives = 59/135 (43%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE +++M+ +G EP T+N L++ A + ++ ME+ PD TY++
Sbjct: 203 VEELLWVWRKMKENGIEPTLYTYNFLMNGLVSAMFVDSAERVFEVMESGRIKPDIVTYNT 262

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+I G ++G Q A+E ++ G ++I D+ + + EM + G
Sbjct: 263 MIKGYCKAGQTQKAMEKLRDMETRGHEADKITYMTMIQACYADSDFGSCVALYQEMDEKG 322

Query: 361 CSPDDWTFRALCFGL 405
F + GL
Sbjct: 323 IQVPPHAFSLVIGGL 337



Score = 48.9 bits (115), Expect = 1e-05
Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 1/121 (0%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEAR-GCGPDPYTYS 177
++E F+EM GC ++ +N LI AF K + L ME GC YTY+
Sbjct: 448 VDEAERLFEEMSEKGCTRDSYCYNALIDAFTKHRKVDEAIALFKRMEEEEGCDQTVYTYT 507

Query: 178 SLIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQF 357
L+ G+ + + A+++++ + G T A ++ L ++ A +E+
Sbjct: 508 ILLSGMFKEHRNEEALKLWDMMIDKGITPTAACFRALSTGLCLSGKVARACKILDELAPM 567

Query: 358 G 360
G
Sbjct: 568 G 568


>sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing
protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580
PE=3 SV=1
Length = 763

Score = 85.9 bits (211), Expect = 1e-16
Identities = 48/134 (35%), Positives = 69/134 (51%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
+E Y +M N G EP++ T+NTLI + K GM +L +++ + G PD +TY SL
Sbjct: 303 QEAEVYLGKMVNEGLEPDSYTYNTLIAGYCKGGMVQLAERIVGDAVFNGFVPDQFTYRSL 362

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
IDGL G A+ +FN+ G V + N++I L I +A NEM + G
Sbjct: 363 IDGLCHEGETNRALALFNEALGKGIKPNVILYNTLIKGLSNQGMILEAAQLANEMSEKGL 422

Query: 364 SPDDWTFRALCFGL 405
P+ TF L GL
Sbjct: 423 IPEVQTFNILVNGL 436



Score = 64.3 bits (155), Expect = 3e-10
Identities = 34/122 (27%), Positives = 62/122 (50%)
Frame = +1

Query: 28 EMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSG 207
EM G P TFN L++ K G + L+ M ++G PD +T++ LI G
Sbjct: 416 EMSEKGLIPEVQTFNILVNGLCKMGCVSDADGLVKVMISKGYFPDIFTFNILIHGYSTQL 475

Query: 208 SVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFR 387
++ A+E+ + + G V NS++ L + ++ +D ++ + M + GC+P+ +TF
Sbjct: 476 KMENALEILDVMLDNGVDPDVYTYNSLLNGLCKTSKFEDVMETYKTMVEKGCAPNLFTFN 535

Query: 388 AL 393
L
Sbjct: 536 IL 537



Score = 63.9 bits (154), Expect = 4e-10
Identities = 37/124 (29%), Positives = 61/124 (49%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M + G P+ TFN LIH ++ E ++++ M G PD YTY+SL++GL ++
Sbjct: 452 MISKGYFPDIFTFNILIHGYSTQLKMENALEILDVMLDNGVDPDVYTYNSLLNGLCKTSK 511

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
+ +E + + G + N ++ L R ++D+AL EM +PD TF
Sbjct: 512 FEDVMETYKTMVEKGCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGT 571

Query: 391 LCFG 402
L G
Sbjct: 572 LIDG 575



Score = 63.5 bits (153), Expect = 5e-10
Identities = 39/136 (28%), Positives = 65/136 (47%)
Frame = +1

Query: 16 AYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGL 195
A F E G +PN + +NTLI + GM +L NEM +G P+ T++ L++GL
Sbjct: 377 ALFNEALGKGIKPNVILYNTLIKGLSNQGMILEAAQLANEMSEKGLIPEVQTFNILVNGL 436

Query: 196 GRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDD 375
+ G V A + + G + N +I ++++AL+ + M G PD
Sbjct: 437 CKMGCVSDADGLVKVMISKGYFPDIFTFNILIHGYSTQLKMENALEILDVMLDNGVDPDV 496

Query: 376 WTFRALCFGLKNAKRF 423
+T+ +L GL +F
Sbjct: 497 YTYNSLLNGLCKTSKF 512



Score = 62.0 bits (149), Expect = 2e-09
Identities = 39/132 (29%), Positives = 63/132 (47%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLI 186
EGY F +M SG TFN L+ K G + KL++++ RG P+ +TY+ I
Sbjct: 199 EGYELFGKMLASGVSLCLSTFNKLLRVLCKKGDVKECEKLLDKVIKRGVLPNLFTYNLFI 258

Query: 187 DGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCS 366
GL + G + A+ + L G V N++I L ++++ +A +M G
Sbjct: 259 QGLCQRGELDGAVRMVGCLIEQGPKPDVITYNNLIYGLCKNSKFQEAEVYLGKMVNEGLE 318

Query: 367 PDDWTFRALCFG 402
PD +T+ L G
Sbjct: 319 PDSYTYNTLIAG 330



Score = 60.8 bits (146), Expect = 3e-09
Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
Frame = +1

Query: 1 LEEGYAYFQEMENS-GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYS 177
L+ Y F++ME + + T+N +IHAF + + KL EM R GPD YTY
Sbjct: 582 LDGAYTLFRKMEEAYKVSSSTPTYNIIIHAFTEKLNVTMAEKLFQEMVDRCLGPDGYTYR 641

Query: 178 SLIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQF 357
++DG ++G+V + ++ G ++ +I L ++R+ +A + M Q
Sbjct: 642 LMVDGFCKTGNVNLGYKFLLEMMENGFIPSLTTLGRVINCLCVEDRVYEAAGIIHRMVQK 701

Query: 358 GCSPD 372
G P+
Sbjct: 702 GLVPE 706



Score = 57.8 bits (138), Expect = 3e-08
Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 1/128 (0%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
++ M GC PN TFN L+ + + + L+ EM+ + PD T+ +LIDG +
Sbjct: 519 YKTMVEKGCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGTLIDGFCK 578

Query: 202 SGSVQTAIEVFNQL-KVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDW 378
+G + A +F ++ + + N II + A F EM PD +
Sbjct: 579 NGDLDGAYTLFRKMEEAYKVSSSTPTYNIIIHAFTEKLNVTMAEKLFQEMVDRCLGPDGY 638

Query: 379 TFRALCFG 402
T+R + G
Sbjct: 639 TYRLMVDG 646



Score = 55.5 bits (132), Expect = 1e-07
Identities = 36/123 (29%), Positives = 53/123 (43%)
Frame = +1

Query: 43 GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTA 222
G +P+ +T+N LI+ K + + +M G PD YTY++LI G + G VQ A
Sbjct: 281 GPKPDVITYNNLIYGLCKNSKFQEAEVYLGKMVNEGLEPDSYTYNTLIAGYCKGGMVQLA 340

Query: 223 IEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFG 402
+ G S+I L + + AL FNE G P+ + L G
Sbjct: 341 ERIVGDAVFNGFVPDQFTYRSLIDGLCHEGETNRALALFNEALGKGIKPNVILYNTLIKG 400

Query: 403 LKN 411
L N
Sbjct: 401 LSN 403



Score = 50.4 bits (119), Expect = 5e-06
Identities = 25/134 (18%), Positives = 59/134 (44%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
++ + + M + G P+ +F + +F K +L+N M ++GC + Y ++
Sbjct: 128 DQAHKVYMRMRDRGITPDVYSFTIRMKSFCKTSRPHAALRLLNNMSSQGCEMNVVAYCTV 187

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
+ G E+F ++ G L ++ N ++ VL + + + +++ + G
Sbjct: 188 VGGFYEENFKAEGYELFGKMLASGVSLCLSTFNKLLRVLCKKGDVKECEKLLDKVIKRGV 247

Query: 364 SPDDWTFRALCFGL 405
P+ +T+ GL
Sbjct: 248 LPNLFTYNLFIQGL 261



Score = 45.8 bits (107), Expect = 1e-04
Identities = 24/118 (20%), Positives = 53/118 (44%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E M ++G +P+ T+N+L++ K E + M +GC P+ +T++
Sbjct: 477 MENALEILDVMLDNGVDPDVYTYNSLLNGLCKTSKFEDVMETYKTMVEKGCAPNLFTFNI 536

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQ 354
L++ L R + A+ + ++K ++I ++ +D A F +M +
Sbjct: 537 LLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGTLIDGFCKNGDLDGAYTLFRKMEE 594



Score = 40.0 bits (92), Expect = 0.006
Identities = 35/125 (28%), Positives = 53/125 (42%), Gaps = 6/125 (4%)
Frame = +1

Query: 28 EMENS-----GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEM-EARGCGPDPYTYSSLID 189
EM NS G + T+ ++I G E +++ +M E G Y +
Sbjct: 25 EMFNSMRKEVGFKHTLSTYRSVIEKLGYYGKFEAMEEVLVDMRENVGNHMLEGVYVGAMK 84

Query: 190 GLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSP 369
GR G VQ A+ VF ++ TV N+I+ VLV D A + M G +P
Sbjct: 85 NYGRKGKVQEAVNVFERMDFYDCEPTVFSYNAIMSVLVDSGYFDQAHKVYMRMRDRGITP 144

Query: 370 DDWTF 384
D ++F
Sbjct: 145 DVYSF 149


>sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein
At1g13040, mitochondrial OS=Arabidopsis thaliana
GN=At1g13040 PE=2 SV=1
Length = 517

Score = 85.1 bits (209), Expect = 2e-16
Identities = 46/138 (33%), Positives = 72/138 (52%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLI 186
+ Y F+EM G N VT+ +LI AF + G + + KL+++M G PD Y++++
Sbjct: 343 KAYRLFEEMRQKGMVMNVVTYTSLIKAFLREGNSSVAKKLLDQMTELGLSPDRIFYTTIL 402

Query: 187 DGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCS 366
D L +SG+V A VFN + NS+I L R R+ +A+ F +M C
Sbjct: 403 DHLCKSGNVDKAYGVFNDMIEHEITPDAISYNSLISGLCRSGRVTEAIKLFEDMKGKECC 462

Query: 367 PDDWTFRALCFGLKNAKR 420
PD+ TF+ + GL K+
Sbjct: 463 PDELTFKFIIGGLIRGKK 480



Score = 53.5 bits (127), Expect = 6e-07
Identities = 27/97 (27%), Positives = 51/97 (52%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ Y F +M P+A+++N+LI ++G KL +M+ + C PD T+
Sbjct: 411 VDKAYGVFNDMIEHEITPDAISYNSLISGLCRSGRVTEAIKLFEDMKGKECCPDELTFKF 470

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSII 291
+I GL R + A +V++Q+ G L V +++I
Sbjct: 471 IIGGLIRGKKLSAAYKVWDQMMDKGFTLDRDVSDTLI 507



Score = 52.8 bits (125), Expect = 9e-07
Identities = 36/122 (29%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M G EP+ V++ LI+ +AG ++ N M G PD ++L+ GL +
Sbjct: 140 MVQRGREPDVVSYTILINGLFRAGKVTDAVEIWNAMIRSGVSPDNKACAALVVGLCHARK 199

Query: 211 VQTAIE-VFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFR 387
V A E V ++K L+ V N++I + RI+ A + M + GC PD T+
Sbjct: 200 VDLAYEMVAEEIKSARVKLSTVVYNALISGFCKAGRIEKAEALKSYMSKIGCEPDLVTYN 259

Query: 388 AL 393
L
Sbjct: 260 VL 261



Score = 52.4 bits (124), Expect = 1e-06
Identities = 41/161 (25%), Positives = 69/161 (42%), Gaps = 37/161 (22%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAF--------AKAGMAELT------------- 117
+E+ A M GCEP+ VT+N L++ + A+ MAE+
Sbjct: 236 IEKAEALKSYMSKIGCEPDLVTYNVLLNYYYDNNMLKRAEGVMAEMVRSGIQLDAYSYNQ 295

Query: 118 ---------------NKLMNEMEARG-CGPDPYTYSSLIDGLGRSGSVQTAIEVFNQLKV 249
N ++ EME RG C D +YS+LI+ R+ + + A +F +++
Sbjct: 296 LLKRHCRVSHPDKCYNFMVKEMEPRGFC--DVVSYSTLIETFCRASNTRKAYRLFEEMRQ 353

Query: 250 LGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPD 372
G + V S+I +R+ A ++M + G SPD
Sbjct: 354 KGMVMNVVTYTSLIKAFLREGNSSVAKKLLDQMTELGLSPD 394



Score = 48.9 bits (115), Expect = 1e-05
Identities = 34/138 (24%), Positives = 58/138 (42%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++ F EM +S + +N I + EL + +M+ G P+TYS
Sbjct: 25 IDNAVQVFDEMRHSSYRVFSFDYNRFIGVLVRESRFELAEAIYWDMKPMGFSLIPFTYSR 84

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
I GL + + + ++ LG + N + +L R+N++ A+ F M Q G
Sbjct: 85 FISGLCKVKKFDLIDALLSDMETLGFIPDIWAFNVYLDLLCRENKVGFAVQTFFCMVQRG 144

Query: 361 CSPDDWTFRALCFGLKNA 414
PD ++ L GL A
Sbjct: 145 REPDVVSYTILINGLFRA 162



Score = 42.4 bits (98), Expect = 0.001
Identities = 30/108 (27%), Positives = 50/108 (46%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
+E++++ + + V +N LI F KAG E L + M GC PD TY+ L++ +
Sbjct: 209 EEIKSARVKLSTVVYNALISGFCKAGRIEKAEALKSYMSKIGCEPDLVTYNVLLNYYYDN 268

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEM 348
++ A V ++ G L N + L R R+ C+N M
Sbjct: 269 NMLKRAEGVMAEMVRSGIQLDAYSYNQL---LKRHCRVSHPDKCYNFM 313



Score = 38.1 bits (87), Expect = 0.024
Identities = 25/84 (29%), Positives = 42/84 (50%)
Frame = +1

Query: 172 YSSLIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMP 351
Y S I L +SG + A++VF++++ + N I VLVR++R + A + +M
Sbjct: 12 YRSRIANLVKSGMIDNAVQVFDEMRHSSYRVFSFDYNRFIGVLVRESRFELAEAIYWDMK 71

Query: 352 QFGCSPDDWTFRALCFGLKNAKRF 423
G S +T+ GL K+F
Sbjct: 72 PMGFSLIPFTYSRFISGLCKVKKF 95


>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein
At3g22470, mitochondrial OS=Arabidopsis thaliana
GN=At3g22470 PE=2 SV=1
Length = 619

Score = 85.1 bits (209), Expect = 2e-16
Identities = 42/135 (31%), Positives = 72/135 (53%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++G F+E+ + G PN +T+NTL+ F ++G +L EM +RG P TY
Sbjct: 401 VDDGMRLFREISSKGLIPNTITYNTLVLGFCQSGKLNAAKELFQEMVSRGVPPSVVTYGI 460

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L+DGL +G + A+E+F +++ L + + N II + +++DDA F + G
Sbjct: 461 LLDGLCDNGELNKALEIFEKMQKSRMTLGIGIYNIIIHGMCNASKVDDAWSLFCSLSDKG 520

Query: 361 CSPDDWTFRALCFGL 405
PD T+ + GL
Sbjct: 521 VKPDVVTYNVMIGGL 535



Score = 71.2 bits (173), Expect = 3e-12
Identities = 41/133 (30%), Positives = 63/133 (47%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
++G +EM P+ VTF+ LI F K G +L NEM RG PD TY+SL
Sbjct: 297 DDGAKMLREMIGRNIIPDVVTFSALIDVFVKEGKLLEAKELYNEMITRGIAPDTITYNSL 356

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
IDG + + A ++F+ + G + + +I + R+DD + F E+ G
Sbjct: 357 IDGFCKENCLHEANQMFDLMVSKGCEPDIVTYSILINSYCKAKRVDDGMRLFREISSKGL 416

Query: 364 SPDDWTFRALCFG 402
P+ T+ L G
Sbjct: 417 IPNTITYNTLVLG 429



Score = 69.7 bits (169), Expect = 7e-12
Identities = 42/139 (30%), Positives = 68/139 (48%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
++ + F EME G + + VT+++LI G + K++ EM R PD T+S+L
Sbjct: 262 DDALSLFNEMEMKGIKADVVTYSSLIGGLCNDGKWDDGAKMLREMIGRNIIPDVVTFSAL 321

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
ID + G + A E++N++ G NS+I ++N + +A F+ M GC
Sbjct: 322 IDVFVKEGKLLEAKELYNEMITRGIAPDTITYNSLIDGFCKENCLHEANQMFDLMVSKGC 381

Query: 364 SPDDWTFRALCFGLKNAKR 420
PD T+ L AKR
Sbjct: 382 EPDIVTYSILINSYCKAKR 400



Score = 66.6 bits (161), Expect = 6e-11
Identities = 37/135 (27%), Positives = 63/135 (46%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L E + EM G P+ +T+N+LI F K N++ + M ++GC PD TYS
Sbjct: 331 LLEAKELYNEMITRGIAPDTITYNSLIDGFCKENCLHEANQMFDLMVSKGCEPDIVTYSI 390

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+ ++ V + +F ++ G N+++ + +++ A + F EM G
Sbjct: 391 LINSYCKAKRVDDGMRLFREISSKGLIPNTITYNTLVLGFCQSGKLNAAKELFQEMVSRG 450

Query: 361 CSPDDWTFRALCFGL 405
P T+ L GL
Sbjct: 451 VPPSVVTYGILLDGL 465



Score = 64.3 bits (155), Expect = 3e-10
Identities = 39/131 (29%), Positives = 60/131 (45%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+ E M G +P+ VT+ +++ K+G + L L +ME R YS
Sbjct: 191 VSEALVLIDRMVEYGFQPDEVTYGPVLNRLCKSGNSALALDLFRKMEERNIKASVVQYSI 250

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+ID L + GS A+ +FN++++ G V +S+I L D + DD EM
Sbjct: 251 VIDSLCKDGSFDDALSLFNEMEMKGIKADVVTYSSLIGGLCNDGKWDDGAKMLREMIGRN 310

Query: 361 CSPDDWTFRAL 393
PD TF AL
Sbjct: 311 IIPDVVTFSAL 321



Score = 63.9 bits (154), Expect = 4e-10
Identities = 41/137 (29%), Positives = 64/137 (46%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+ E A M P+ VT +TLI+ G L++ M G PD TY
Sbjct: 156 VSEAVALVDRMVEMKQRPDLVTVSTLINGLCLKGRVSEALVLIDRMVEYGFQPDEVTYGP 215

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+++ L +SG+ A+++F +++ +V + +I L +D DDAL FNEM G
Sbjct: 216 VLNRLCKSGNSALALDLFRKMEERNIKASVVQYSIVIDSLCKDGSFDDALSLFNEMEMKG 275

Query: 361 CSPDDWTFRALCFGLKN 411
D T+ +L GL N
Sbjct: 276 IKADVVTYSSLIGGLCN 292



Score = 63.5 bits (153), Expect = 5e-10
Identities = 37/127 (29%), Positives = 64/127 (50%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F++ME + + V ++ +I + K G + L NEME +G D TYSSLI GL
Sbjct: 233 FRKMEERNIKASVVQYSIVIDSLCKDGSFDDALSLFNEMEMKGIKADVVTYSSLIGGLCN 292

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
G ++ ++ V +++I V V++ ++ +A + +NEM G +PD T
Sbjct: 293 DGKWDDGAKMLREMIGRNIIPDVVTFSALIDVFVKEGKLLEAKELYNEMITRGIAPDTIT 352

Query: 382 FRALCFG 402
+ +L G
Sbjct: 353 YNSLIDG 359



Score = 57.8 bits (138), Expect = 3e-08
Identities = 32/108 (29%), Positives = 59/108 (54%), Gaps = 1/108 (0%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ ++ F + + G +P+ VT+N +I K G + L +M+ GC PD +TY+
Sbjct: 506 VDDAWSLFCSLSDKGVKPDVVTYNVMIGGLCKKGSLSEADMLFRKMKEDGCTPDDFTYNI 565

Query: 181 LIDG-LGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRID 321
LI LG SG + +++E+ ++KV G + +I +L D R+D
Sbjct: 566 LIRAHLGGSGLI-SSVELIEEMKVCGFSADSSTIKMVIDML-SDRRLD 611



Score = 45.4 bits (106), Expect = 2e-04
Identities = 26/118 (22%), Positives = 55/118 (46%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
ME +G E + T +I+ + + ++ G PD T+S+L++G G
Sbjct: 96 MELNGIEHDMYTMTIMINCYCRKKKLLFAFSVLGRAWKLGYEPDTITFSTLVNGFCLEGR 155

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
V A+ + +++ + + +++I L R+ +AL + M ++G PD+ T+
Sbjct: 156 VSEAVALVDRMVEMKQRPDLVTVSTLINGLCLKGRVSEALVLIDRMVEYGFQPDEVTY 213



Score = 45.4 bits (106), Expect = 2e-04
Identities = 31/129 (24%), Positives = 55/129 (42%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L + F++M+ S +N +IH A + L + +G PD TY+
Sbjct: 471 LNKALEIFEKMQKSRMTLGIGIYNIIIHGMCNASKVDDAWSLFCSLSDKGVKPDVVTYNV 530

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+I GL + GS+ A +F ++K G N +I + + + +++ EM G
Sbjct: 531 MIGGLCKKGSLSEADMLFRKMKEDGCTPDDFTYNILIRAHLGGSGLISSVELIEEMKVCG 590

Query: 361 CSPDDWTFR 387
S D T +
Sbjct: 591 FSADSSTIK 599


>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein
At3g53700, chloroplastic OS=Arabidopsis thaliana
GN=MEE40 PE=2 SV=1
Length = 754

Score = 84.0 bits (206), Expect = 4e-16
Identities = 39/124 (31%), Positives = 68/124 (54%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+EM + GCEP+ T+N LI + G + ++ +ME GC TY++LIDG +
Sbjct: 423 FEEMRSKGCEPDEFTYNMLIDSLCSKGKLDEALNMLKQMELSGCARSVITYNTLIDGFCK 482

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
+ + A E+F++++V G N++I L + R++DA ++M G PD +T
Sbjct: 483 ANKTREAEEIFDEMEVHGVSRNSVTYNTLIDGLCKSRRVEDAAQLMDQMIMEGQKPDKYT 542

Query: 382 FRAL 393
+ +L
Sbjct: 543 YNSL 546



Score = 83.6 bits (205), Expect = 5e-16
Identities = 46/136 (33%), Positives = 74/136 (54%), Gaps = 1/136 (0%)
Frame = +1

Query: 1 LEEGYAYFQEMENS-GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYS 177
+E+ + QEM N G P+ TFNTL++ KAG + ++M+ M G PD YTY+
Sbjct: 275 VEDALNFIQEMSNQDGFFPDQYTFNTLVNGLCKAGHVKHAIEIMDVMLQEGYDPDVYTYN 334

Query: 178 SLIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQF 357
S+I GL + G V+ A+EV +Q+ N++I L ++N++++A + +
Sbjct: 335 SVISGLCKLGEVKEAVEVLDQMITRDCSPNTVTYNTLISTLCKENQVEEATELARVLTSK 394

Query: 358 GCSPDDWTFRALCFGL 405
G PD TF +L GL
Sbjct: 395 GILPDVCTFNSLIQGL 410



Score = 82.4 bits (202), Expect = 1e-15
Identities = 48/140 (34%), Positives = 70/140 (50%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L+E ++ME SGC + +T+NTLI F KA ++ +EME G + TY++
Sbjct: 451 LDEALNMLKQMELSGCARSVITYNTLIDGFCKANKTREAEEIFDEMEVHGVSRNSVTYNT 510

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LIDGL +S V+ A ++ +Q+ + G NS++ R I A D M G
Sbjct: 511 LIDGLCKSRRVEDAAQLMDQMIMEGQKPDKYTYNSLLTHFCRGGDIKKAADIVQAMTSNG 570

Query: 361 CSPDDWTFRALCFGLKNAKR 420
C PD T+ L GL A R
Sbjct: 571 CEPDIVTYGTLISGLCKAGR 590



Score = 75.9 bits (185), Expect = 1e-13
Identities = 41/140 (29%), Positives = 71/140 (50%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE + + + G P+ TFN+LI + +L EM ++GC PD +TY+
Sbjct: 381 VEEATELARVLTSKGILPDVCTFNSLIQGLCLTRNHRVAMELFEEMRSKGCEPDEFTYNM 440

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID L G + A+ + Q+++ G +V N++I + N+ +A + F+EM G
Sbjct: 441 LIDSLCSKGKLDEALNMLKQMELSGCARSVITYNTLIDGFCKANKTREAEEIFDEMEVHG 500

Query: 361 CSPDDWTFRALCFGLKNAKR 420
S + T+ L GL ++R
Sbjct: 501 VSRNSVTYNTLIDGLCKSRR 520



Score = 70.5 bits (171), Expect = 4e-12
Identities = 41/139 (29%), Positives = 70/139 (50%), Gaps = 5/139 (3%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E+ +M G +P+ T+N+L+ F + G + ++ M + GC PD TY +
Sbjct: 521 VEDAAQLMDQMIMEGQKPDKYTYNSLLTHFCRGGDIKKAADIVQAMTSNGCEPDIVTYGT 580

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI GL ++G V+ A ++ +++ G LT N +I L R + +A++ F EM +
Sbjct: 581 LISGLCKAGRVEVASKLLRSIQMKGINLTPHAYNPVIQGLFRKRKTTEAINLFREMLEQN 640

Query: 361 CSPDD-----WTFRALCFG 402
+P D FR LC G
Sbjct: 641 EAPPDAVSYRIVFRGLCNG 659



Score = 68.2 bits (165), Expect = 2e-11
Identities = 38/124 (30%), Positives = 67/124 (54%), Gaps = 1/124 (0%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEAR-GCGPDPYTYSSLIDGLGR 201
++M GC + V+ N ++H F K G E + EM + G PD YT+++L++GL +
Sbjct: 248 EQMVEFGCSWSNVSVNVIVHGFCKEGRVEDALNFIQEMSNQDGFFPDQYTFNTLVNGLCK 307

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
+G V+ AIE+ + + G V NS+I L + + +A++ ++M CSP+ T
Sbjct: 308 AGHVKHAIEIMDVMLQEGYDPDVYTYNSVISGLCKLGEVKEAVEVLDQMITRDCSPNTVT 367

Query: 382 FRAL 393
+ L
Sbjct: 368 YNTL 371



Score = 62.0 bits (149), Expect = 2e-09
Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
Frame = +1

Query: 43 GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTA 222
G +P+ TFN LI A +A ++ +M + G PD T+++++ G G + A
Sbjct: 184 GIKPDVSTFNVLIKALCRAHQLRPAILMLEDMPSYGLVPDEKTFTTVMQGYIEEGDLDGA 243

Query: 223 IEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMP-QFGCSPDDWTFRALCF 399
+ + Q+ G + N I+ ++ R++DAL+ EM Q G PD +TF L
Sbjct: 244 LRIREQMVEFGCSWSNVSVNVIVHGFCKEGRVEDALNFIQEMSNQDGFFPDQYTFNTLVN 303

Query: 400 GLKNA 414
GL A
Sbjct: 304 GLCKA 308



Score = 47.8 bits (112), Expect = 3e-05
Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEM-EARGCGPDPYTYSSLIDGLGR 201
++M++S CE TF LI ++A+ + + +++ M + G PD + Y+ +++ L
Sbjct: 107 EDMKSSRCEMGTSTFLILIESYAQFELQDEILSVVDWMIDEFGLKPDTHFYNRMLNLLVD 166

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
S++ ++ V G V+ N +I L R +++ A+ +MP +G PD+ T
Sbjct: 167 GNSLKLVEISHAKMSVWGIKPDVSTFNVLIKALCRAHQLRPAILMLEDMPSYGLVPDEKT 226

Query: 382 FRALCFG 402
F + G
Sbjct: 227 FTTVMQG 233


>sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein
At1g51965, mitochondrial OS=Arabidopsis thaliana
GN=At1g51965 PE=2 SV=1
Length = 650

Score = 83.2 bits (204), Expect = 7e-16
Identities = 39/131 (29%), Positives = 75/131 (57%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E F+E+E S C+P+ +++N+LI+ K G + + EM+ +G PD TYS+
Sbjct: 493 VDEAINIFEELERSDCKPDIISYNSLINCLGKNGDVDEAHVRFKEMQEKGLNPDVVTYST 552

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L++ G++ V+ A +F ++ V G + N ++ L ++ R +A+D +++M Q G
Sbjct: 553 LMECFGKTERVEMAYSLFEEMLVKGCQPNIVTYNILLDCLEKNGRTAEAVDLYSKMKQQG 612

Query: 361 CSPDDWTFRAL 393
+PD T+ L
Sbjct: 613 LTPDSITYTVL 623



Score = 70.5 bits (171), Expect = 4e-12
Identities = 37/129 (28%), Positives = 68/129 (52%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLI 186
+ + + E+ G + + +N L+ A AK E ++ +M+ R C D YTY+ +I
Sbjct: 221 KAFDVYCEIRRGGHKLDIFAYNMLLDALAKD---EKACQVFEDMKKRHCRRDEYTYTIMI 277

Query: 187 DGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCS 366
+GR G A+ +FN++ G L V N+++ VL + +D A+ F+ M + GC
Sbjct: 278 RTMGRIGKCDEAVGLFNEMITEGLTLNVVGYNTLMQVLAKGKMVDKAIQVFSRMVETGCR 337

Query: 367 PDDWTFRAL 393
P+++T+ L
Sbjct: 338 PNEYTYSLL 346



Score = 68.6 bits (166), Expect = 2e-11
Identities = 37/124 (29%), Positives = 64/124 (51%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F++M+ G P+ T+N LI +F + G + + E+E C PD +Y+SLI+ LG+
Sbjct: 465 FEKMKKDGPSPDIFTYNILIASFGRVGEVDEAINIFEELERSDCKPDIISYNSLINCLGK 524

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
+G V A F +++ G V ++++ + R++ A F EM GC P+ T
Sbjct: 525 NGDVDEAHVRFKEMQEKGLNPDVVTYSTLMECFGKTERVEMAYSLFEEMLVKGCQPNIVT 584

Query: 382 FRAL 393
+ L
Sbjct: 585 YNIL 588



Score = 48.9 bits (115), Expect = 1e-05
Identities = 30/118 (25%), Positives = 55/118 (46%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
+E F EM G N V +NTL+ AK M + ++ + M GC P+ YTYS L
Sbjct: 287 DEAVGLFNEMITEGLTLNVVGYNTLMQVLAKGKMVDKAIQVFSRMVETGCRPNEYTYSLL 346

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQF 357
++ L G + + + +++ +T + + ++ L + + +A F +M F
Sbjct: 347 LNLLVAEGQL---VRLDGVVEISKRYMTQGIYSYLVRTLSKLGHVSEAHRLFCDMWSF 401



Score = 46.6 bits (109), Expect = 7e-05
Identities = 26/136 (19%), Positives = 64/136 (47%), Gaps = 2/136 (1%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+ E + F +M + + ++ +++ + AG ++++++ +G D Y++
Sbjct: 388 VSEAHRLFCDMWSFPVKGERDSYMSMLESLCGAGKTIEAIEMLSKIHEKGVVTDTMMYNT 447

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+ LG+ + ++F ++K G + N +I R +D+A++ F E+ +
Sbjct: 448 VFSALGKLKQISHIHDLFEKMKKDGPSPDIFTYNILIASFGRVGEVDEAINIFEELERSD 507

Query: 361 CSPDDWTFRAL--CFG 402
C PD ++ +L C G
Sbjct: 508 CKPDIISYNSLINCLG 523



Score = 38.9 bits (89), Expect = 0.014
Identities = 21/84 (25%), Positives = 39/84 (46%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
E+ F++M+ C + T+ +I + G + L NEM G + Y++L
Sbjct: 252 EKACQVFEDMKKRHCRRDEYTYTIMIRTMGRIGKCDEAVGLFNEMITEGLTLNVVGYNTL 311

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLG 255
+ L + V AI+VF+++ G
Sbjct: 312 MQVLAKGKMVDKAIQVFSRMVETG 335


>sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein
At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1
Length = 621

Score = 83.2 bits (204), Expect = 7e-16
Identities = 44/135 (32%), Positives = 73/135 (54%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++G F++M G + VT+NTLI F + G E+ +L EM +R PD +Y
Sbjct: 403 IDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLEVAKELFQEMVSRRVRPDIVSYKI 462

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L+DGL +G + A+E+F +++ L + + N II + +++DDA D F +P G
Sbjct: 463 LLDGLCDNGEPEKALEIFEKIEKSKMELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKG 522

Query: 361 CSPDDWTFRALCFGL 405
PD T+ + GL
Sbjct: 523 VKPDVKTYNIMIGGL 537



Score = 68.2 bits (165), Expect = 2e-11
Identities = 36/135 (26%), Positives = 67/135 (49%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L E +EM G P+ VT+ +LI F K + N +++ M ++GCGP+ T++
Sbjct: 333 LREAEELHKEMIQRGISPDTVTYTSLIDGFCKENQLDKANHMLDLMVSKGCGPNIRTFNI 392

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+G ++ + +E+F ++ + G N++I +++ A + F EM
Sbjct: 393 LINGYCKANLIDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLEVAKELFQEMVSRR 452

Query: 361 CSPDDWTFRALCFGL 405
PD +++ L GL
Sbjct: 453 VRPDIVSYKILLDGL 467



Score = 66.2 bits (160), Expect = 8e-11
Identities = 38/125 (30%), Positives = 62/125 (49%), Gaps = 2/125 (1%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M +G +PN VT+ ++ K+G L +L+ +ME R D YS +IDGL + GS
Sbjct: 203 MVETGFQPNEVTYGPVLKVMCKSGQTALAMELLRKMEERKIKLDAVKYSIIIDGLCKDGS 262

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
+ A +FN++++ G + + ++I R DD +M + +PD F A
Sbjct: 263 LDNAFNLFNEMEIKGFKADIIIYTTLIRGFCYAGRWDDGAKLLRDMIKRKITPDVVAFSA 322

Query: 391 L--CF 399
L CF
Sbjct: 323 LIDCF 327



Score = 64.7 bits (156), Expect = 2e-10
Identities = 40/133 (30%), Positives = 59/133 (44%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
++G ++M P+ V F+ LI F K G +L EM RG PD TY+SL
Sbjct: 299 DDGAKLLRDMIKRKITPDVVAFSALIDCFVKEGKLREAEELHKEMIQRGISPDTVTYTSL 358

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
IDG + + A + + + G + N +I + N IDD L+ F +M G
Sbjct: 359 IDGFCKENQLDKANHMLDLMVSKGCGPNIRTFNILINGYCKANLIDDGLELFRKMSLRGV 418

Query: 364 SPDDWTFRALCFG 402
D T+ L G
Sbjct: 419 VADTVTYNTLIQG 431



Score = 62.8 bits (151), Expect = 9e-10
Identities = 39/134 (29%), Positives = 63/134 (47%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L+ + F EME G + + + + TLI F AG + KL+ +M R PD +S+
Sbjct: 263 LDNAFNLFNEMEIKGFKADIIIYTTLIRGFCYAGRWDDGAKLLRDMIKRKITPDVVAFSA 322

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID + G ++ A E+ ++ G S+I ++N++D A + M G
Sbjct: 323 LIDCFVKEGKLREAEELHKEMIQRGISPDTVTYTSLIDGFCKENQLDKANHMLDLMVSKG 382

Query: 361 CSPDDWTFRALCFG 402
C P+ TF L G
Sbjct: 383 CGPNIRTFNILING 396



Score = 54.7 bits (130), Expect = 2e-07
Identities = 31/120 (25%), Positives = 61/120 (50%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
++ME G N T + +I+ + L M ++ G PD T+S+LI+GL
Sbjct: 96 KQMELKGIAHNLYTLSIMINCCCRCRKLSLAFSAMGKIIKLGYEPDTVTFSTLINGLCLE 155

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
G V A+E+ +++ +G T+ N+++ L + ++ DA+ + M + G P++ T+
Sbjct: 156 GRVSEALELVDRMVEMGHKPTLITLNALVNGLCLNGKVSDAVLLIDRMVETGFQPNEVTY 215



Score = 51.2 bits (121), Expect = 3e-06
Identities = 35/128 (27%), Positives = 56/128 (43%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
FQEM S P + F+ L A+ +L L +ME +G + YT S +I+ R
Sbjct: 60 FQEMTRSRPRPRLIDFSRLFSVVARTKQYDLVLDLCKQMELKGIAHNLYTLSIMINCCCR 119

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
+ A ++ LG +++I L + R+ +AL+ + M + G P T
Sbjct: 120 CRKLSLAFSAMGKIIKLGYEPDTVTFSTLINGLCLEGRVSEALELVDRMVEMGHKPTLIT 179

Query: 382 FRALCFGL 405
AL GL
Sbjct: 180 LNALVNGL 187



Score = 50.1 bits (118), Expect = 6e-06
Identities = 35/141 (24%), Positives = 59/141 (41%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+ E M G +P +T N L++ G L++ M G P+ TY
Sbjct: 158 VSEALELVDRMVEMGHKPTLITLNALVNGLCLNGKVSDAVLLIDRMVETGFQPNEVTYGP 217

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
++ + +SG A+E+ +++ L + II L +D +D+A + FNEM G
Sbjct: 218 VLKVMCKSGQTALAMELLRKMEERKIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKG 277

Query: 361 CSPDDWTFRALCFGLKNAKRF 423
D + L G A R+
Sbjct: 278 FKADIIIYTTLIRGFCYAGRW 298



Score = 42.4 bits (98), Expect = 0.001
Identities = 30/128 (23%), Positives = 55/128 (42%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
E+ F+++E S E + +N +IH A + L + +G PD TY+ +
Sbjct: 474 EKALEIFEKIEKSKMELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKGVKPDVKTYNIM 533

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
I GL + GS+ A +F +++ G N +I + + + E+ + G
Sbjct: 534 IGGLCKKGSLSEADLLFRKMEEDGHSPNGCTYNILIRAHLGEGDATKSAKLIEEIKRCGF 593

Query: 364 SPDDWTFR 387
S D T +
Sbjct: 594 SVDASTVK 601



Score = 40.0 bits (92), Expect = 0.006
Identities = 23/65 (35%), Positives = 32/65 (49%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L E F++ME G PN T+N LI A G A + KL+ E++ G D T
Sbjct: 543 LSEADLLFRKMEEDGHSPNGCTYNILIRAHLGEGDATKSAKLIEEIKRCGFSVDASTVKM 602

Query: 181 LIDGL 195
++D L
Sbjct: 603 VVDML 607



Score = 37.7 bits (86), Expect = 0.032
Identities = 21/100 (21%), Positives = 44/100 (44%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ + F + G +P+ T+N +I K G + L +ME G P+ TY+
Sbjct: 508 VDDAWDLFCSLPLKGVKPDVKTYNIMIGGLCKKGSLSEADLLFRKMEEDGHSPNGCTYNI 567

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVL 300
LI G + ++ ++K G + + ++ +L
Sbjct: 568 LIRAHLGEGDATKSAKLIEEIKRCGFSVDASTVKMVVDML 607


>sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protein
At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1
Length = 506

Score = 82.8 bits (203), Expect = 9e-16
Identities = 42/140 (30%), Positives = 72/140 (51%), Gaps = 1/140 (0%)
Frame = +1

Query: 4 EEGYAYFQEM-ENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E F++M G P+ VTFN +I+ F +AG E K+++ M+ GC P+ Y YS+
Sbjct: 249 KEAVELFEDMISKEGISPDPVTFNVMINGFCRAGEVERAKKILDFMKKNGCNPNVYNYSA 308

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L++G + G +Q A + F+++K G L +++ R+ D+A+ EM
Sbjct: 309 LMNGFCKVGKIQEAKQTFDEVKKTGLKLDTVGYTTLMNCFCRNGETDEAMKLLGEMKASR 368

Query: 361 CSPDDWTFRALCFGLKNAKR 420
C D T+ + GL + R
Sbjct: 369 CRADTLTYNVILRGLSSEGR 388



Score = 52.4 bits (124), Expect = 1e-06
Identities = 35/129 (27%), Positives = 66/129 (51%), Gaps = 4/129 (3%)
Frame = +1

Query: 25 QEMENSGCE-PNAVTFNTLIHA-FAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLG 198
+EM+ SG PN++T++TL+ FA + E + + G PDP T++ +I+G
Sbjct: 220 EEMKRSGISYPNSITYSTLMDCLFAHSRSKEAVELFEDMISKEGISPDPVTFNVMINGFC 279

Query: 199 RSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDW 378
R+G V+ A ++ + +K G V ++++ + +I +A F+E+ + G D
Sbjct: 280 RAGEVERAKKILDFMKKNGCNPNVYNYSALMNGFCKVGKIQEAKQTFDEVKKTGLKLDTV 339

Query: 379 TFRAL--CF 399
+ L CF
Sbjct: 340 GYTTLMNCF 348



Score = 49.7 bits (117), Expect = 8e-06
Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 4/126 (3%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M+ +GC PN ++ L++ F K G + + +E++ G D Y++L++ R+G
Sbjct: 294 MKKNGCNPNVYNYSALMNGFCKVGKIQEAKQTFDEVKKTGLKLDTVGYTTLMNCFCRNGE 353

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFR- 387
A+++ ++K N I+ L + R ++AL ++ G + ++R
Sbjct: 354 TDEAMKLLGEMKASRCRADTLTYNVILRGLSSEGRSEEALQMLDQWGSEGVHLNKGSYRI 413

Query: 388 ---ALC 396
ALC
Sbjct: 414 ILNALC 419



Score = 30.0 bits (66), Expect = 6.6
Identities = 15/81 (18%), Positives = 37/81 (45%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LE+ + M G P+ T+N L+ ++G E+ +++ G P P ++ +
Sbjct: 424 LEKAVKFLSVMSERGIWPHHATWNELVVRLCESGYTEIGVRVLIGFLRIGLIPGPKSWGA 483

Query: 181 LIDGLGRSGSVQTAIEVFNQL 243
+++ + + + E+ + L
Sbjct: 484 VVESICKERKLVHVFELLDSL 504


tr_hit_id A9TCK1
Definition tr|A9TCK1|A9TCK1_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 133
Score (bit) 106.0
E-value 6.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914265|Adiantum capillus-veneris mRNA, clone:
YMU001_000056_H11.
(509 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TCK1|A9TCK1_PHYPA Predicted protein (Fragment) OS=Physcomit... 106 6e-22
tr|A5AXD2|A5AXD2_VITVI Putative uncharacterized protein OS=Vitis... 100 4e-20
tr|A9TFE2|A9TFE2_PHYPA Predicted protein OS=Physcomitrella paten... 99 9e-20
tr|A7QI89|A7QI89_VITVI Chromosome chr17 scaffold_101, whole geno... 96 1e-18
tr|A9RQM0|A9RQM0_PHYPA Predicted protein OS=Physcomitrella paten... 94 4e-18
tr|Q84TY4|Q84TY4_ORYSJ Os03g0597200 protein OS=Oryza sativa subs... 92 2e-17
tr|A3AK50|A3AK50_ORYSJ Putative uncharacterized protein OS=Oryza... 92 2e-17
tr|A2XJ76|A2XJ76_ORYSI Putative uncharacterized protein OS=Oryza... 92 2e-17
tr|A9S042|A9S042_PHYPA Predicted protein OS=Physcomitrella paten... 91 3e-17
tr|A7PSR1|A7PSR1_VITVI Chromosome chr8 scaffold_29, whole genome... 91 3e-17
tr|Q69L95|Q69L95_ORYSJ Os07g0101200 protein OS=Oryza sativa subs... 91 4e-17
tr|B8B6I1|B8B6I1_ORYSI Putative uncharacterized protein OS=Oryza... 91 4e-17
tr|A3BFQ2|A3BFQ2_ORYSJ Putative uncharacterized protein OS=Oryza... 91 4e-17
tr|A7NUI8|A7NUI8_VITVI Chromosome chr18 scaffold_1, whole genome... 90 5e-17
tr|Q6ETX2|Q6ETX2_ORYSJ Os02g0266200 protein OS=Oryza sativa subs... 90 7e-17
tr|A2X384|A2X384_ORYSI Putative uncharacterized protein OS=Oryza... 90 7e-17
tr|A7PT63|A7PT63_VITVI Chromosome chr8 scaffold_29, whole genome... 89 9e-17
tr|A5C167|A5C167_VITVI Putative uncharacterized protein OS=Vitis... 89 9e-17
tr|A2Q1M9|A2Q1M9_MEDTR Tetratricopeptide-like helical OS=Medicag... 89 9e-17
tr|Q9AY93|Q9AY93_ORYSA Putative membrane-associated salt-inducib... 88 3e-16
tr|Q10HZ9|Q10HZ9_ORYSJ cDNA clone:J023045J04, full insert sequen... 88 3e-16
tr|Q0DQQ9|Q0DQQ9_ORYSJ Os03g0569800 protein OS=Oryza sativa subs... 88 3e-16
tr|A3AJP5|A3AJP5_ORYSJ Putative uncharacterized protein OS=Oryza... 88 3e-16
tr|A2XIP3|A2XIP3_ORYSI Putative uncharacterized protein OS=Oryza... 88 3e-16
tr|A7QW79|A7QW79_VITVI Chromosome chr3 scaffold_199, whole genom... 87 4e-16
tr|A7P654|A7P654_VITVI Chromosome chr4 scaffold_6, whole genome ... 87 4e-16
tr|A7PZJ6|A7PZJ6_VITVI Chromosome chr15 scaffold_40, whole genom... 87 5e-16
tr|Q6DT78|Q6DT78_ARALP AT1G03560 (Fragment) OS=Arabidopsis lyrat... 87 6e-16
tr|A7P711|A7P711_VITVI Chromosome chr9 scaffold_7, whole genome ... 87 6e-16
tr|A5CBK8|A5CBK8_VITVI Putative uncharacterized protein OS=Vitis... 87 6e-16

>tr|A9TCK1|A9TCK1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_220990 PE=4 SV=1
Length = 499

Score = 106 bits (265), Expect = 6e-22
Identities = 57/133 (42%), Positives = 77/133 (57%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+EM+N C PN +T++ LI A K G E K+ +M++RGC P+ +TY+S+IDGLG+
Sbjct: 147 FEEMQNQNCSPNVITYSILIDAVCKCGGVEKALKVFLDMKSRGCRPNIFTYTSMIDGLGK 206

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
SG V A +F ++ G T V NS+I L R R D A F EM G PD T
Sbjct: 207 SGHVDKAFFLFEEMTSEGLVATRVVYNSLIHGLGRSGRADAAAKLFREMLSKGLQPDHVT 266

Query: 382 FRALCFGLKNAKR 420
F +L +GL A R
Sbjct: 267 FTSLVYGLGVAGR 279



Score = 94.4 bits (233), Expect = 3e-18
Identities = 48/140 (34%), Positives = 79/140 (56%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ + F+EM + G V +N+LIH ++G A+ KL EM ++G PD T++S
Sbjct: 210 VDKAFFLFEEMTSEGLVATRVVYNSLIHGLGRSGRADAAAKLFREMLSKGLQPDHVTFTS 269

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L+ GLG +G A +F + + +G L V + N +I L + R+D+A + F E+ + G
Sbjct: 270 LVYGLGVAGRASEARRIFQEARDVGCALDVNLYNVLIDTLCKSKRLDEAWEIFGELEEDG 329

Query: 361 CSPDDWTFRALCFGLKNAKR 420
PD +TF AL GL + R
Sbjct: 330 LVPDVYTFNALMDGLCKSGR 349



Score = 76.6 bits (187), Expect = 6e-13
Identities = 47/140 (33%), Positives = 74/140 (52%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L+E + F E+E G P+ TFN L+ K+G L+ +M+ GC PD Y++
Sbjct: 315 LDEAWEIFGELEEDGLVPDVYTFNALMDGLCKSGRIHDAFILLGDMKRAGCTPDVTVYNT 374

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LIDGL +SG V+ A ++ +++ LG V N++I + RI+DAL F E+ G
Sbjct: 375 LIDGLRKSGRVEEAGQLLLEMQSLGYEPDVVTYNTLIDESCKGGRIEDALRLFEEISAKG 434

Query: 361 CSPDDWTFRALCFGLKNAKR 420
+ + T+ + GL A R
Sbjct: 435 FA-NTVTYNTILNGLCMAGR 453



Score = 70.1 bits (170), Expect = 6e-11
Identities = 40/129 (31%), Positives = 63/129 (48%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLI 186
E FQE + GC + +N LI K+ + ++ E+E G PD YT+++L+
Sbjct: 282 EARRIFQEARDVGCALDVNLYNVLIDTLCKSKRLDEAWEIFGELEEDGLVPDVYTFNALM 341

Query: 187 DGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCS 366
DGL +SG + A + +K G V V N++I L + R+++A EM G
Sbjct: 342 DGLCKSGRIHDAFILLGDMKRAGCTPDVTVYNTLIDGLRKSGRVEEAGQLLLEMQSLGYE 401

Query: 367 PDDWTFRAL 393
PD T+ L
Sbjct: 402 PDVVTYNTL 410



Score = 55.1 bits (131), Expect = 2e-06
Identities = 30/82 (36%), Positives = 48/82 (58%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE EM++ G EP+ VT+NTLI K G E +L E+ A+G + TY++
Sbjct: 385 VEEAGQLLLEMQSLGYEPDVVTYNTLIDESCKGGRIEDALRLFEEISAKGFA-NTVTYNT 443

Query: 181 LIDGLGRSGSVQTAIEVFNQLK 246
+++GL +G V A ++FN +K
Sbjct: 444 ILNGLCMAGRVDEAYKLFNGMK 465



Score = 50.8 bits (120), Expect = 4e-05
Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 6/122 (4%)
Frame = +1

Query: 67 FNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTAIEVFNQLK 246
F L +A AG+ E + + + ME C Y+SLID ++G Q A+ V+ +
Sbjct: 57 FIELARGYASAGLLEKSVEALKRMEGHRCALTASAYNSLIDAFVKAGYTQKALAVYRVMG 116

Query: 247 VLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRAL------CFGLK 408
G N ++ + R+D F EM CSP+ T+ L C G++
Sbjct: 117 QSGLRPDTYTFNVLMNAFKKAKRVDSVWKLFEEMQNQNCSPNVITYSILIDAVCKCGGVE 176

Query: 409 NA 414
A
Sbjct: 177 KA 178



Score = 47.8 bits (112), Expect = 3e-04
Identities = 34/137 (24%), Positives = 57/137 (41%), Gaps = 1/137 (0%)
Frame = +1

Query: 13 YAYFQEMENS-GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLID 189
Y +F+ + G P+ TL+ A +++ E+E P + L
Sbjct: 3 YKFFKWVRTQRGGVPSVRACTTLVEMLGIARRFNEAEEVLAEVEKSRYILQPRIFIELAR 62

Query: 190 GLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSP 369
G +G ++ ++E +++ LT + NS+I V+ AL + M Q G P
Sbjct: 63 GYASAGLLEKSVEALKRMEGHRCALTASAYNSLIDAFVKAGYTQKALAVYRVMGQSGLRP 122

Query: 370 DDWTFRALCFGLKNAKR 420
D +TF L K AKR
Sbjct: 123 DTYTFNVLMNAFKKAKR 139



Score = 38.5 bits (88), Expect = 0.19
Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARG----CGPDPY 168
+E+ F+E+ G N VT+NT+++ AG + KL N M+ PD
Sbjct: 420 IEDALRLFEEISAKGFA-NTVTYNTILNGLCMAGRVDEAYKLFNGMKQETVDGVIDPDFV 478

Query: 169 TYSSLIDGLGRSGSVQTA 222
TY++L++G ++G + A
Sbjct: 479 TYTTLLNGARQAGLSELA 496


>tr|A5AXD2|A5AXD2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_039434 PE=4 SV=1
Length = 722

Score = 100 bits (249), Expect = 4e-20
Identities = 53/142 (37%), Positives = 77/142 (54%), Gaps = 1/142 (0%)
Frame = +1

Query: 1 LEEGYAYFQE-MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYS 177
L+E A E M + GC P+ T+NTLI K G +LMNEM+ +GC P+ TY+
Sbjct: 369 LDEAKAVMHESMLSVGCGPDIFTYNTLILGLCKKGYLVSARELMNEMQIKGCEPNVITYT 428

Query: 178 SLIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQF 357
LID + G ++ A V +++ G L N +I L +D ++ DAL+ F +M
Sbjct: 429 ILIDRFCKEGRLEEARNVLDEMSGKGLALNAVGYNCLISALCKDEKVQDALNMFGDMSSK 488

Query: 358 GCSPDDWTFRALCFGLKNAKRF 423
GC PD +TF +L FGL +F
Sbjct: 489 GCKPDIFTFNSLIFGLCKVNKF 510



Score = 85.1 bits (209), Expect = 2e-15
Identities = 48/134 (35%), Positives = 70/134 (52%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
EE +Q+M G N +T+NTLIHAF + G + KL+N+M RGC D TY+ L
Sbjct: 511 EEALGLYQDMLLEGVIANTITYNTLIHAFLRRGAMQEALKLVNDMLFRGCPLDDITYNGL 570

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
I L R+G+++ + +F + G CN +I L R I AL+ +M G
Sbjct: 571 IKALCRAGNIEKGLALFEDMMSKGLNPNNISCNILINGLCRTGNIQHALEFLRDMIHRGL 630

Query: 364 SPDDWTFRALCFGL 405
+PD T+ +L GL
Sbjct: 631 TPDIVTYNSLINGL 644



Score = 75.5 bits (184), Expect = 1e-12
Identities = 41/131 (31%), Positives = 71/131 (54%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E+G A F++M + G PN ++ N LI+ + G + + + +M RG PD TY+S
Sbjct: 580 IEKGLALFEDMMSKGLNPNNISCNILINGLCRTGNIQHALEFLRDMIHRGLTPDIVTYNS 639

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+GL ++G Q A+ +F++L+V G C N++I ++ DDA + G
Sbjct: 640 LINGLCKTGRAQEALNLFDKLQVEGICPDAITYNTLISWHCKEGMFDDAHLLLSRGVDSG 699

Query: 361 CSPDDWTFRAL 393
P++ T+ L
Sbjct: 700 FIPNEVTWYIL 710



Score = 71.6 bits (174), Expect = 2e-11
Identities = 42/138 (30%), Positives = 65/138 (47%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE EM G NAV +N LI A K + + +M ++GC PD +T++S
Sbjct: 440 LEEARNVLDEMSGKGLALNAVGYNCLISALCKDEKVQDALNMFGDMSSKGCKPDIFTFNS 499

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI GL + + A+ ++ + + G N++I +R + +AL N+M G
Sbjct: 500 LIFGLCKVNKFEEALGLYQDMLLEGVIANTITYNTLIHAFLRRGAMQEALKLVNDMLFRG 559

Query: 361 CSPDDWTFRALCFGLKNA 414
C DD T+ L L A
Sbjct: 560 CPLDDITYNGLIKALCRA 577



Score = 68.2 bits (165), Expect = 2e-10
Identities = 37/122 (30%), Positives = 60/122 (49%)
Frame = +1

Query: 28 EMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSG 207
EM+ GCEPN +T+ LI F K G E +++EM +G + Y+ LI L +
Sbjct: 414 EMQIKGCEPNVITYTILIDRFCKEGRLEEARNVLDEMSGKGLALNAVGYNCLISALCKDE 473

Query: 208 SVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFR 387
VQ A+ +F + G + NS+I L + N+ ++AL + +M G + T+
Sbjct: 474 KVQDALNMFGDMSSKGCKPDIFTFNSLIFGLCKVNKFEEALGLYQDMLLEGVIANTITYN 533

Query: 388 AL 393
L
Sbjct: 534 TL 535



Score = 64.7 bits (156), Expect = 2e-09
Identities = 49/171 (28%), Positives = 69/171 (40%), Gaps = 36/171 (21%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPD------ 162
++ A ++M GC PNA+ + TLIHA K G KL+ EM GC PD
Sbjct: 233 VDSACALLKDMTRHGCVPNAIVYQTLIHALXKVGRVNEVLKLLEEMLLMGCIPDVNTFND 292

Query: 163 -----------------------------PYTYSSLIDGLGRSGSVQTAIEVFNQLKVLG 255
+TY L+ GL R G V A + N++
Sbjct: 293 AIHGLCKMLRIHEAAKLVDRMLLRGFTPNSFTYGVLMHGLCRMGKVDEARMLLNKV---- 348

Query: 256 TCLTVAVCNSIICVLVRDNRIDDALDCFNE-MPQFGCSPDDWTFRALCFGL 405
V + N++I V R+D+A +E M GC PD +T+ L GL
Sbjct: 349 PNPNVVLFNTLINGYVSRGRLDEAKAVMHESMLSVGCGPDIFTYNTLILGL 399



Score = 34.7 bits (78), Expect = 2.7
Identities = 19/68 (27%), Positives = 34/68 (50%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
+E F +++ G P+A+T+NTLI K GM + + L++ G P+ T+ L
Sbjct: 651 QEALNLFDKLQVEGICPDAITYNTLISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYIL 710

Query: 184 IDGLGRSG 207
+ + G
Sbjct: 711 VSNFIKEG 718


>tr|A9TFE2|A9TFE2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_144816 PE=4 SV=1
Length = 621

Score = 99.4 bits (246), Expect = 9e-20
Identities = 52/141 (36%), Positives = 81/141 (57%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L+E ++ME GC P+ +T+NTLI+ KAG+ +L + M+++GC PD TYS+
Sbjct: 305 LDEACQVLKKMEKEGCPPDTITYNTLINGLGKAGLLNDAGRLFDRMKSKGCNPDVVTYST 364

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI LG++ V++A +F +++ +G + SII VL + ++DDA F+EM G
Sbjct: 365 LITALGKAARVESACVLFEEMESVGIQPDLFTYCSIITVLGKAGQVDDADRLFSEMRGKG 424

Query: 361 CSPDDWTFRALCFGLKNAKRF 423
SPD T+ A L RF
Sbjct: 425 LSPDVITYNAFLNSLGRGGRF 445



Score = 98.6 bits (244), Expect = 2e-19
Identities = 50/134 (37%), Positives = 73/134 (54%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L E + F EM GC P+ T+N+LI+ K G ++ +L+ EME GC PD TYSS
Sbjct: 130 LSEAFTLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMTYSS 189

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI GLG+ G A ++F ++K G +++ L + R+DDAL+ +EM + G
Sbjct: 190 LITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMDALGKAGRVDDALELLDEMKERG 249

Query: 361 CSPDDWTFRALCFG 402
P T+ AL G
Sbjct: 250 VKPGVVTYNALIAG 263



Score = 90.5 bits (223), Expect = 4e-17
Identities = 44/139 (31%), Positives = 81/139 (58%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
EE F+E++ + P+ V+++ LI++ +AG E +++ EM+A+GC P+ +TY++L
Sbjct: 26 EEAQLLFEELKAAKWTPDVVSYSCLINSLGRAGKWEAALEVVAEMQAKGCKPNLWTYNTL 85

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
+D LG++G A+ + +++ G V N +I L + R+ +A F EM + GC
Sbjct: 86 VDCLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLISTLGKAGRLSEAFTLFAEMRERGC 145

Query: 364 SPDDWTFRALCFGLKNAKR 420
PD +T+ +L +GL R
Sbjct: 146 VPDTFTYNSLIYGLGKVGR 164



Score = 89.0 bits (219), Expect = 1e-16
Identities = 50/139 (35%), Positives = 72/139 (51%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L + F M++ GC P+ VT++TLI A KA E L EME+ G PD +TY S
Sbjct: 340 LNDAGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYCS 399

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+I LG++G V A +F++++ G V N+ + L R R +A F +M + G
Sbjct: 400 IITVLGKAGQVDDADRLFSEMRGKGLSPDVITYNAFLNSLGRGGRFKEARKIFEDMKESG 459

Query: 361 CSPDDWTFRALCFGLKNAK 417
PD T+ AL GL K
Sbjct: 460 LLPDVATYDALLLGLSKTK 478



Score = 88.6 bits (218), Expect = 2e-16
Identities = 53/139 (38%), Positives = 70/139 (50%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
+E EM ++GC P+ T+N LI KAG L EM RGC PD +TY+SL
Sbjct: 96 DEALRLLAEMRDNGCVPDVRTYNCLISTLGKAGRLSEAFTLFAEMRERGCVPDTFTYNSL 155

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
I GLG+ G Q A+E+ +++ G V +S+I L +D A F EM + G
Sbjct: 156 IYGLGKVGRSQKAMELLEEMERHGCPPDVMTYSSLITGLGKDGETVKAFKLFQEMKRRGR 215

Query: 364 SPDDWTFRALCFGLKNAKR 420
PD TF AL L A R
Sbjct: 216 KPDSITFTALMDALGKAGR 234



Score = 88.2 bits (217), Expect = 2e-16
Identities = 46/126 (36%), Positives = 68/126 (53%)
Frame = +1

Query: 28 EMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSG 207
EM+ GC+PN T+NTL+ KAG + +L+ EM GC PD TY+ LI LG++G
Sbjct: 69 EMQAKGCKPNLWTYNTLVDCLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLISTLGKAG 128

Query: 208 SVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFR 387
+ A +F +++ G NS+I L + R A++ EM + GC PD T+
Sbjct: 129 RLSEAFTLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMTYS 188

Query: 388 ALCFGL 405
+L GL
Sbjct: 189 SLITGL 194



Score = 87.8 bits (216), Expect = 3e-16
Identities = 44/128 (34%), Positives = 73/128 (57%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L E Y EM+ +GC+P+ VT++ LI KA + +++ +ME GC PD TY++
Sbjct: 270 LVEAYNLLDEMKRNGCKPDVVTYSCLITGLIKASQLDEACQVLKKMEKEGCPPDTITYNT 329

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+GLG++G + A +F+++K G V +++I L + R++ A F EM G
Sbjct: 330 LINGLGKAGLLNDAGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLFEEMESVG 389

Query: 361 CSPDDWTF 384
PD +T+
Sbjct: 390 IQPDLFTY 397



Score = 85.1 bits (209), Expect = 2e-15
Identities = 45/132 (34%), Positives = 73/132 (55%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
+EME GC P+ +T+++LI K G KL EM+ RG PD T+++L+D LG++
Sbjct: 173 EEMERHGCPPDVMTYSSLITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMDALGKA 232

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
G V A+E+ +++K G V N++I + + +A + +EM + GC PD T+
Sbjct: 233 GRVDDALELLDEMKERGVKPGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKPDVVTY 292

Query: 385 RALCFGLKNAKR 420
L GL A +
Sbjct: 293 SCLITGLIKASQ 304



Score = 85.1 bits (209), Expect = 2e-15
Identities = 44/136 (32%), Positives = 76/136 (55%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLI 186
+ + FQEM+ G +P+++TF L+ A KAG + +L++EM+ RG P TY++LI
Sbjct: 202 KAFKLFQEMKRRGRKPDSITFTALMDALGKAGRVDDALELLDEMKERGVKPGVVTYNALI 261

Query: 187 DGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCS 366
G G+ G + A + +++K G V + +I L++ +++D+A +M + GC
Sbjct: 262 AGFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLITGLIKASQLDEACQVLKKMEKEGCP 321

Query: 367 PDDWTFRALCFGLKNA 414
PD T+ L GL A
Sbjct: 322 PDTITYNTLINGLGKA 337



Score = 80.5 bits (197), Expect = 4e-14
Identities = 39/128 (30%), Positives = 69/128 (53%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E F+EME+ G +P+ T+ ++I KAG + ++L +EM +G PD TY++
Sbjct: 375 VESACVLFEEMESVGIQPDLFTYCSIITVLGKAGQVDDADRLFSEMRGKGLSPDVITYNA 434

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
++ LGR G + A ++F +K G VA ++++ L + +DDA E+ + G
Sbjct: 435 FLNSLGRGGRFKEARKIFEDMKESGLLPDVATYDALLLGLSKTKEVDDACGLLKELIEQG 494

Query: 361 CSPDDWTF 384
C+ D F
Sbjct: 495 CAFDSLKF 502



Score = 79.3 bits (194), Expect = 1e-13
Identities = 45/123 (36%), Positives = 67/123 (54%)
Frame = +1

Query: 52 PNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTAIEV 231
PN VT+N+L++A AKAG E L E++A PD +YS LI+ LGR+G + A+EV
Sbjct: 7 PNVVTYNSLLNALAKAGQCEEAQLLFEELKAAKWTPDVVSYSCLINSLGRAGKWEAALEV 66

Query: 232 FNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFGLKN 411
+++ G + N+++ L + + D+AL EM GC PD T+ L L
Sbjct: 67 VAEMQAKGCKPNLWTYNTLVDCLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLISTLGK 126

Query: 412 AKR 420
A R
Sbjct: 127 AGR 129



Score = 77.8 bits (190), Expect = 3e-13
Identities = 45/140 (32%), Positives = 69/140 (49%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ EM+ G +P VT+N LI F K G L++EM+ GC PD TYS
Sbjct: 235 VDDALELLDEMKERGVKPGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSC 294

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI GL ++ + A +V +++ G N++I L + ++DA F+ M G
Sbjct: 295 LITGLIKASQLDEACQVLKKMEKEGCPPDTITYNTLINGLGKAGLLNDAGRLFDRMKSKG 354

Query: 361 CSPDDWTFRALCFGLKNAKR 420
C+PD T+ L L A R
Sbjct: 355 CNPDVVTYSTLITALGKAAR 374



Score = 57.4 bits (137), Expect = 4e-07
Identities = 29/89 (32%), Positives = 48/89 (53%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E + Q + G P A ++N LI A AKAG + +++ +G PD +YSS
Sbjct: 515 VDEAHELLQFANSKGLWPGASSYNALIDALAKAGRVSEAFNTLEDLKEQGGKPDIVSYSS 574

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLT 267
LI LG++G + TA E+ ++ G L+
Sbjct: 575 LISALGQTGQIDTAFELLEEMSKRGLKLS 603



Score = 53.9 bits (128), Expect = 4e-06
Identities = 32/133 (24%), Positives = 57/133 (42%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F EM G P+ +T+N +++ + G + K+ +M+ G PD TY +L+ GL +
Sbjct: 417 FSEMRGKGLSPDVITYNAFLNSLGRGGRFKEARKIFEDMKESGLLPDVATYDALLLGLSK 476

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
+ V A + +L G + + +L +D+A + G P +
Sbjct: 477 TKEVDDACGLLKELIEQGCAFDSLKFDECLEILTSWGNVDEAHELLQFANSKGLWPGASS 536

Query: 382 FRALCFGLKNAKR 420
+ AL L A R
Sbjct: 537 YNALIDALAKAGR 549


>tr|A7QI89|A7QI89_VITVI Chromosome chr17 scaffold_101, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000137001
PE=4 SV=1
Length = 764

Score = 95.9 bits (237), Expect = 1e-18
Identities = 48/133 (36%), Positives = 75/133 (56%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLI 186
E Y ++M N G EP+ T+N++I + K GM + ++++ + +G PD TY SLI
Sbjct: 303 EAEHYLRKMVNEGYEPDGFTYNSIIDGYCKLGMMQNADQILRDGAFKGFVPDESTYCSLI 362

Query: 187 DGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCS 366
+GL + G + AI VFN+ G + +CN+++ L + I AL NEM + GCS
Sbjct: 363 NGLCQDGDIDRAINVFNEAMEKGLKPNLVLCNTLVKGLSQQGLILQALKLMNEMSENGCS 422

Query: 367 PDDWTFRALCFGL 405
PD WT+ + GL
Sbjct: 423 PDIWTYNLVINGL 435



Score = 74.3 bits (181), Expect = 3e-12
Identities = 43/134 (32%), Positives = 68/134 (50%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F E G +PN V NTL+ ++ G+ KLMNEM GC PD +TY+ +I+GL +
Sbjct: 378 FNEAMEKGLKPNLVLCNTLVKGLSQQGLILQALKLMNEMSENGCSPDIWTYNLVINGLCK 437

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
G V A + G V N++I + ++D+A++ + M G SPD T
Sbjct: 438 IGCVSDADNLVIDAIAKGHLPDVFTFNTLIDGYCKKLKLDNAIEIVDRMWNHGVSPDVIT 497

Query: 382 FRALCFGLKNAKRF 423
+ ++ GL A ++
Sbjct: 498 YNSILNGLCKAGKY 511



Score = 68.2 bits (165), Expect = 2e-10
Identities = 38/131 (29%), Positives = 67/131 (51%)
Frame = +1

Query: 28 EMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSG 207
EM +GC P+ T+N +I+ K G + L+ + A+G PD +T+++LIDG +
Sbjct: 415 EMSENGCSPDIWTYNLVINGLCKIGCVSDADNLVIDAIAKGHLPDVFTFNTLIDGYCKKL 474

Query: 208 SVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFR 387
+ AIE+ +++ G V NSI+ L + + +D + F M + GC P+ T+
Sbjct: 475 KLDNAIEIVDRMWNHGVSPDVITYNSILNGLCKAGKYEDVMGTFKLMMEKGCVPNIITYN 534

Query: 388 ALCFGLKNAKR 420
L A++
Sbjct: 535 ILTESFCKARK 545



Score = 67.4 bits (163), Expect = 4e-10
Identities = 40/134 (29%), Positives = 67/134 (50%), Gaps = 1/134 (0%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
E+ F+ M GC PN +T+N L +F KA E L+ EM+ +G PD + +L
Sbjct: 512 EDVMGTFKLMMEKGCVPNIITYNILTESFCKARKVEEALNLIEEMQNKGLTPDVVNFGTL 571

Query: 184 IDGLGRSGSVQTAIEVFNQL-KVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+ G +G + A ++F ++ + T+A N +I ++ A FN+M + G
Sbjct: 572 MKGFCDNGDLDGAYQLFKRVDEQYKFSHTIATYNIMINAFAGKLNMNMAEKLFNKMCENG 631

Query: 361 CSPDDWTFRALCFG 402
SPD +T+R + G
Sbjct: 632 FSPDSYTYRVMIDG 645



Score = 61.6 bits (148), Expect = 2e-08
Identities = 38/134 (28%), Positives = 68/134 (50%), Gaps = 2/134 (1%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLI 186
E + F+EM G P+ + FN LIH + G + + +L+N++ RG P+ +T + I
Sbjct: 199 EAHELFEEMLGLGICPDIMAFNKLIHTLCRKGHVQESERLLNKVLKRGVSPNLFTVNIFI 258

Query: 187 DGLGRSGSVQTAIEVFNQLKVLGTCLT--VAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
G + + AI + L +G LT V N++IC L ++ ++ +A +M G
Sbjct: 259 QGFCQRAMLNEAIRL---LDGVGRGLTPDVITYNTLICGLCKNFKVVEAEHYLRKMVNEG 315

Query: 361 CSPDDWTFRALCFG 402
PD +T+ ++ G
Sbjct: 316 YEPDGFTYNSIIDG 329



Score = 57.8 bits (138), Expect = 3e-07
Identities = 29/126 (23%), Positives = 57/126 (45%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
++ + + M + G P+ TF + +F + +L+N M ++GC Y ++
Sbjct: 128 DQAHKVYMRMRDKGIVPDVYTFTIRMKSFCRTSRPHAARRLLNNMPSQGCESSAVAYCTV 187

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
I G A E+F ++ LG C + N +I L R + ++ N++ + G
Sbjct: 188 IGGFYEENHRVEAHELFEEMLGLGICPDIMAFNKLIHTLCRKGHVQESERLLNKVLKRGV 247

Query: 364 SPDDWT 381
SP+ +T
Sbjct: 248 SPNLFT 253



Score = 57.0 bits (136), Expect = 5e-07
Identities = 31/117 (26%), Positives = 56/117 (47%)
Frame = +1

Query: 52 PNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTAIEV 231
P+ TFNTLI + K + ++++ M G PD TY+S+++GL ++G + +
Sbjct: 458 PDVFTFNTLIDGYCKKLKLDNAIEIVDRMWNHGVSPDVITYNSILNGLCKAGKYEDVMGT 517

Query: 232 FNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFG 402
F + G + N + + ++++AL+ EM G +PD F L G
Sbjct: 518 FKLMMEKGCVPNIITYNILTESFCKARKVEEALNLIEEMQNKGLTPDVVNFGTLMKG 574



Score = 47.4 bits (111), Expect = 4e-04
Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 1/125 (0%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAV-TFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYS 177
L+ Y F+ ++ + + T+N +I+AFA + KL N+M G PD YTY
Sbjct: 581 LDGAYQLFKRVDEQYKFSHTIATYNIMINAFAGKLNMNMAEKLFNKMCENGFSPDSYTYR 640

Query: 178 SLIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQF 357
+IDG ++G++ + G ++ ++ L R+ +A+ + M
Sbjct: 641 VMIDGFCKTGNINSGYSFLLVKIEKGLIPSLTTFGRVLNCLCLKRRVHEAVGIIHLMVHK 700

Query: 358 GCSPD 372
G P+
Sbjct: 701 GIVPE 705


>tr|A9RQM0|A9RQM0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_177326 PE=4 SV=1
Length = 528

Score = 94.0 bits (232), Expect = 4e-18
Identities = 47/140 (33%), Positives = 74/140 (52%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L+ F EM+ G +P+ VT+N L+ A AG KL ++M GC PD YTYS+
Sbjct: 186 LDMALGLFAEMKRRGFQPSVVTYNILLDALCSAGRVGAARKLFHKMTGDGCSPDSYTYST 245

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L++GLG+SG V+ A +VF ++ G + + NS++ L + +D EM + G
Sbjct: 246 LVNGLGKSGRVEEAHKVFREMVDRGVAVDLVNYNSLLATLAKAGNMDRVWKLMKEMSRKG 305

Query: 361 CSPDDWTFRALCFGLKNAKR 420
PD ++F + L A +
Sbjct: 306 FHPDAFSFNTIMDALGKANK 325



Score = 76.6 bits (187), Expect = 6e-13
Identities = 45/123 (36%), Positives = 62/123 (50%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
+EM +G P T+N+LIH A G + ++ EME GC PD TY+ L+D LG+
Sbjct: 369 EEMVEAGFIPETKTYNSLIHWLATDGQVDEAFAVLEEMETAGCRPDVVTYNRLMDMLGKR 428

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
G Q A +F Q+K G I L D+R+D+AL F +M GC D +
Sbjct: 429 GENQRAARLFQQMKDKGVEPDTLSYAVRIDGLAFDDRLDEALVLFKDMKAVGCPVDKAMY 488

Query: 385 RAL 393
R L
Sbjct: 489 RIL 491



Score = 76.3 bits (186), Expect = 8e-13
Identities = 43/140 (30%), Positives = 70/140 (50%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L+ F+EM+ G EP+ T+ L++A KAG + + M RG P+ TY+
Sbjct: 116 LDSAMEMFREMKIKGSEPDEYTYGFLVNALGKAGRVQEARSFFDAMLERGLTPNIPTYNL 175

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L+D + G + A+ +F ++K G +V N ++ L R+ A F++M G
Sbjct: 176 LMDAFRKVGQLDMALGLFAEMKRRGFQPSVVTYNILLDALCSAGRVGAARKLFHKMTGDG 235

Query: 361 CSPDDWTFRALCFGLKNAKR 420
CSPD +T+ L GL + R
Sbjct: 236 CSPDSYTYSTLVNGLGKSGR 255



Score = 73.2 bits (178), Expect = 7e-12
Identities = 39/131 (29%), Positives = 61/131 (46%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++ + +EM G P+A +FNT++ A KA + ++ M GC PD +Y+
Sbjct: 291 MDRVWKLMKEMSRKGFHPDAFSFNTIMDALGKANKPDAAREVFARMVESGCKPDLISYNI 350

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID R G A ++ ++ G NS+I L D ++D+A EM G
Sbjct: 351 LIDSYARFGDAAQARQMLEEMVEAGFIPETKTYNSLIHWLATDGQVDEAFAVLEEMETAG 410

Query: 361 CSPDDWTFRAL 393
C PD T+ L
Sbjct: 411 CRPDVVTYNRL 421



Score = 71.6 bits (174), Expect = 2e-11
Identities = 39/139 (28%), Positives = 68/139 (48%)
Frame = +1

Query: 4 EEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSL 183
E ++++ GC+ + +N LI F ++G + ++ EM+ +G PD YTY L
Sbjct: 82 ERAELVYKKLVQKGCQLDRFAYNVLIRYFGRSGQLDSAMEMFREMKIKGSEPDEYTYGFL 141

Query: 184 IDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGC 363
++ LG++G VQ A F+ + G + N ++ + ++D AL F EM + G
Sbjct: 142 VNALGKAGRVQEARSFFDAMLERGLTPNIPTYNLLMDAFRKVGQLDMALGLFAEMKRRGF 201

Query: 364 SPDDWTFRALCFGLKNAKR 420
P T+ L L +A R
Sbjct: 202 QPSVVTYNILLDALCSAGR 220



Score = 68.6 bits (166), Expect = 2e-10
Identities = 35/117 (29%), Positives = 61/117 (52%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F +M GC P++ T++TL++ K+G E +K+ EM RG D Y+SL+ L +
Sbjct: 228 FHKMTGDGCSPDSYTYSTLVNGLGKSGRVEEAHKVFREMVDRGVAVDLVNYNSLLATLAK 287

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPD 372
+G++ ++ ++ G N+I+ L + N+ D A + F M + GC PD
Sbjct: 288 AGNMDRVWKLMKEMSRKGFHPDAFSFNTIMDALGKANKPDAAREVFARMVESGCKPD 344



Score = 66.6 bits (161), Expect = 7e-10
Identities = 39/131 (29%), Positives = 66/131 (50%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE + F+EM + G + V +N+L+ AKAG + KLM EM +G PD +++++
Sbjct: 256 VEEAHKVFREMVDRGVAVDLVNYNSLLATLAKAGNMDRVWKLMKEMSRKGFHPDAFSFNT 315

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
++D LG++ A EVF ++ G + N +I R A EM + G
Sbjct: 316 IMDALGKANKPDAAREVFARMVESGCKPDLISYNILIDSYARFGDAAQARQMLEEMVEAG 375

Query: 361 CSPDDWTFRAL 393
P+ T+ +L
Sbjct: 376 FIPETKTYNSL 386



Score = 63.5 bits (153), Expect = 6e-09
Identities = 30/97 (30%), Positives = 53/97 (54%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E +A +EME +GC P+ VT+N L+ K G + +L +M+ +G PD +Y+
Sbjct: 396 VDEAFAVLEEMETAGCRPDVVTYNRLMDMLGKRGENQRAARLFQQMKDKGVEPDTLSYAV 455

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSII 291
IDGL + A+ +F +K +G + A+ +I
Sbjct: 456 RIDGLAFDDRLDEALVLFKDMKAVGCPVDKAMYRILI 492



Score = 61.6 bits (148), Expect = 2e-08
Identities = 33/129 (25%), Positives = 62/129 (48%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLI 186
+ + F + E+ C P F LI +G E + ++ +GC D + Y+ LI
Sbjct: 48 DAFDLFNQAESFACSPTVHAFTKLIDILVNSGEFERAELVYKKLVQKGCQLDRFAYNVLI 107

Query: 187 DGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCS 366
GRSG + +A+E+F ++K+ G+ ++ L + R+ +A F+ M + G +
Sbjct: 108 RYFGRSGQLDSAMEMFREMKIKGSEPDEYTYGFLVNALGKAGRVQEARSFFDAMLERGLT 167

Query: 367 PDDWTFRAL 393
P+ T+ L
Sbjct: 168 PNIPTYNLL 176



Score = 55.5 bits (132), Expect = 2e-06
Identities = 39/132 (29%), Positives = 59/132 (44%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
+EM G T LI A+ + + L N+ E+ C P + ++ LID L S
Sbjct: 19 KEMVAEGRPLRPNTLVKLITAYGRGNKSGDAFDLFNQAESFACSPTVHAFTKLIDILVNS 78

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
G + A V+ +L G L N +I R ++D A++ F EM G PD++T+
Sbjct: 79 GEFERAELVYKKLVQKGCQLDRFAYNVLIRYFGRSGQLDSAMEMFREMKIKGSEPDEYTY 138

Query: 385 RALCFGLKNAKR 420
L L A R
Sbjct: 139 GFLVNALGKAGR 150



Score = 35.0 bits (79), Expect = 2.1
Identities = 19/65 (29%), Positives = 31/65 (47%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
FQ+M++ G EP+ +++ I A + L +M+A GC D Y LI R
Sbjct: 438 FQQMKDKGVEPDTLSYAVRIDGLAFDDRLDEALVLFKDMKAVGCPVDKAMYRILIRAAHR 497

Query: 202 SGSVQ 216
+G +
Sbjct: 498 AGDTE 502


>tr|Q84TY4|Q84TY4_ORYSJ Os03g0597200 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0087M10.16 PE=4 SV=1
Length = 742

Score = 91.7 bits (226), Expect = 2e-17
Identities = 45/124 (36%), Positives = 72/124 (58%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+EM+NSGC P+ VT+NTLI G L+ +ME+ GC TY+++IDGL +
Sbjct: 414 FEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLKDMESTGCPRSTITYNTIIDGLCK 473

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
++ A EVF+Q+ + G N++I L +D +IDDA + N+M G P++ T
Sbjct: 474 KMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCKDKKIDDAFELINQMISEGLQPNNIT 533

Query: 382 FRAL 393
+ ++
Sbjct: 534 YNSI 537



Score = 80.5 bits (197), Expect = 4e-14
Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 4/138 (2%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ + +M + G +PN +T+N+++ + K G + ++ M A G D TY +
Sbjct: 512 IDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDVVTYGT 571

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+GL ++G Q A++V +++ G T N ++ L R N I DAL F EM + G
Sbjct: 572 LINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLFREMAEVG 631

Query: 361 CSPDDWT----FRALCFG 402
PD T FR LC G
Sbjct: 632 EPPDALTYKIVFRGLCRG 649



Score = 78.6 bits (192), Expect = 2e-13
Identities = 47/140 (33%), Positives = 72/140 (51%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE +++ G P+ TFN LI+A K G L +L EM+ GC PD TY++
Sbjct: 372 LEEALDLARQVTVKGVSPDVYTFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNT 431

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID L G + A+++ ++ G + N+II L + RI++A + F++M G
Sbjct: 432 LIDNLCSLGKLGKALDLLKDMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQG 491

Query: 361 CSPDDWTFRALCFGLKNAKR 420
S + TF L GL K+
Sbjct: 492 ISRNAITFNTLIDGLCKDKK 511



Score = 73.9 bits (180), Expect = 4e-12
Identities = 38/131 (29%), Positives = 69/131 (52%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E+ Y Q+ G EP+ +T+NT ++ + K+M+ M G PD +TY+
Sbjct: 267 VEDALGYIQQEIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNI 326

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+++ L ++G ++ A + NQ+ G + N++I L NR+++ALD ++ G
Sbjct: 327 VVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKG 386

Query: 361 CSPDDWTFRAL 393
SPD +TF L
Sbjct: 387 VSPDVYTFNIL 397



Score = 72.0 bits (175), Expect = 2e-11
Identities = 39/128 (30%), Positives = 63/128 (49%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
+ EM G +P+ VTFNTL+ A +A ++ EM +RG PD T+++L+ G
Sbjct: 169 YSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETTFTTLMQGFVE 228

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
GS++ A+ V ++ +G T N +I + R++DAL + G PD T
Sbjct: 229 EGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQEIADGFEPDQIT 288

Query: 382 FRALCFGL 405
+ GL
Sbjct: 289 YNTFVNGL 296



Score = 71.2 bits (173), Expect = 3e-11
Identities = 41/135 (30%), Positives = 62/135 (45%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE +M + GC P+ TFNTLI A E L ++ +G PD YT++
Sbjct: 337 LEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVYTFNI 396

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+ L + G A+ +F ++K G N++I L ++ ALD +M G
Sbjct: 397 LINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLKDMESTG 456

Query: 361 CSPDDWTFRALCFGL 405
C T+ + GL
Sbjct: 457 CPRSTITYNTIIDGL 471



Score = 68.9 bits (167), Expect = 1e-10
Identities = 38/121 (31%), Positives = 61/121 (50%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M G +P+ T+N +++ K G E ++N+M RGC PD T+++LI L
Sbjct: 312 MVQEGHDPDVFTYNIVVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNR 371

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
++ A+++ Q+ V G V N +I L + AL F EM GC+PD+ T+
Sbjct: 372 LEEALDLARQVTVKGVSPDVYTFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNT 431

Query: 391 L 393
L
Sbjct: 432 L 432



Score = 63.2 bits (152), Expect = 7e-09
Identities = 38/132 (28%), Positives = 63/132 (47%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
++ME++GC + +T+NT+I K E ++ ++M+ +G + T+++LIDGL +
Sbjct: 450 KDMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCKD 509

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
+ A E+ NQ+ G NSI+ + I A D M G D T+
Sbjct: 510 KKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDVVTY 569

Query: 385 RALCFGLKNAKR 420
L GL A R
Sbjct: 570 GTLINGLCKAGR 581



Score = 62.4 bits (150), Expect = 1e-08
Identities = 38/130 (29%), Positives = 61/130 (46%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M GC VT N LI+ + K G E + + A G PD TY++ ++GL ++
Sbjct: 242 MLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQEIADGFEPDQITYNTFVNGLCQNDH 301

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
V A++V + + G V N ++ L ++ ++++A N+M GC PD TF
Sbjct: 302 VGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNT 361

Query: 391 LCFGLKNAKR 420
L L R
Sbjct: 362 LIAALCTGNR 371



Score = 52.8 bits (125), Expect = 1e-05
Identities = 31/120 (25%), Positives = 56/120 (46%)
Frame = +1

Query: 43 GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTA 222
G + + V +N L++ + +L + +EM ARG PD T+++L+ L R+ V+TA
Sbjct: 141 GIQADTVVYNHLLNVLVEGSKMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTA 200

Query: 223 IEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFG 402
+ + ++ G +++ V + I+ AL M + GCS T L G
Sbjct: 201 VLMLEEMSSRGVAPDETTFTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLING 260



Score = 33.5 bits (75), Expect = 6.1
Identities = 31/123 (25%), Positives = 47/123 (38%), Gaps = 2/123 (1%)
Frame = +1

Query: 52 PNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTAIE- 228
P + +I G +L L+ EM G S +D A++
Sbjct: 72 PGPEVYEEIIRKLGAVGALDLMKVLVAEMRREGHQVKLGVVHSFLDSYEGQQLFDDAVDL 131

Query: 229 VFNQLKVL-GTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFGL 405
+ NQL+ L G V N ++ VLV +++ ++EM G PD TF L L
Sbjct: 132 ILNQLQPLFGIQADTVVYNHLLNVLVEGSKMKLLESVYSEMGARGIKPDVVTFNTLMKAL 191

Query: 406 KNA 414
A
Sbjct: 192 CRA 194


>tr|A3AK50|A3AK50_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_011172 PE=4 SV=1
Length = 650

Score = 91.7 bits (226), Expect = 2e-17
Identities = 45/124 (36%), Positives = 72/124 (58%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+EM+NSGC P+ VT+NTLI G L+ +ME+ GC TY+++IDGL +
Sbjct: 322 FEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLKDMESTGCPRSTITYNTIIDGLCK 381

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
++ A EVF+Q+ + G N++I L +D +IDDA + N+M G P++ T
Sbjct: 382 KMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCKDKKIDDAFELINQMISEGLQPNNIT 441

Query: 382 FRAL 393
+ ++
Sbjct: 442 YNSI 445



Score = 80.5 bits (197), Expect = 4e-14
Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 4/138 (2%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ + +M + G +PN +T+N+++ + K G + ++ M A G D TY +
Sbjct: 420 IDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDVVTYGT 479

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+GL ++G Q A++V +++ G T N ++ L R N I DAL F EM + G
Sbjct: 480 LINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLFREMAEVG 539

Query: 361 CSPDDWT----FRALCFG 402
PD T FR LC G
Sbjct: 540 EPPDALTYKIVFRGLCRG 557



Score = 78.6 bits (192), Expect = 2e-13
Identities = 47/140 (33%), Positives = 72/140 (51%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE +++ G P+ TFN LI+A K G L +L EM+ GC PD TY++
Sbjct: 280 LEEALDLARQVTVKGVSPDVYTFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNT 339

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID L G + A+++ ++ G + N+II L + RI++A + F++M G
Sbjct: 340 LIDNLCSLGKLGKALDLLKDMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQG 399

Query: 361 CSPDDWTFRALCFGLKNAKR 420
S + TF L GL K+
Sbjct: 400 ISRNAITFNTLIDGLCKDKK 419



Score = 73.9 bits (180), Expect = 4e-12
Identities = 38/131 (29%), Positives = 69/131 (52%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E+ Y Q+ G EP+ +T+NT ++ + K+M+ M G PD +TY+
Sbjct: 175 VEDALGYIQQEIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNI 234

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+++ L ++G ++ A + NQ+ G + N++I L NR+++ALD ++ G
Sbjct: 235 VVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKG 294

Query: 361 CSPDDWTFRAL 393
SPD +TF L
Sbjct: 295 VSPDVYTFNIL 305



Score = 72.0 bits (175), Expect = 2e-11
Identities = 39/128 (30%), Positives = 63/128 (49%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
+ EM G +P+ VTFNTL+ A +A ++ EM +RG PD T+++L+ G
Sbjct: 77 YSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETTFTTLMQGFVE 136

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
GS++ A+ V ++ +G T N +I + R++DAL + G PD T
Sbjct: 137 EGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQEIADGFEPDQIT 196

Query: 382 FRALCFGL 405
+ GL
Sbjct: 197 YNTFVNGL 204



Score = 71.2 bits (173), Expect = 3e-11
Identities = 41/135 (30%), Positives = 62/135 (45%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE +M + GC P+ TFNTLI A E L ++ +G PD YT++
Sbjct: 245 LEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVYTFNI 304

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+ L + G A+ +F ++K G N++I L ++ ALD +M G
Sbjct: 305 LINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLKDMESTG 364

Query: 361 CSPDDWTFRALCFGL 405
C T+ + GL
Sbjct: 365 CPRSTITYNTIIDGL 379



Score = 68.9 bits (167), Expect = 1e-10
Identities = 38/121 (31%), Positives = 61/121 (50%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M G +P+ T+N +++ K G E ++N+M RGC PD T+++LI L
Sbjct: 220 MVQEGHDPDVFTYNIVVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNR 279

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
++ A+++ Q+ V G V N +I L + AL F EM GC+PD+ T+
Sbjct: 280 LEEALDLARQVTVKGVSPDVYTFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNT 339

Query: 391 L 393
L
Sbjct: 340 L 340



Score = 63.2 bits (152), Expect = 7e-09
Identities = 38/132 (28%), Positives = 63/132 (47%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
++ME++GC + +T+NT+I K E ++ ++M+ +G + T+++LIDGL +
Sbjct: 358 KDMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCKD 417

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
+ A E+ NQ+ G NSI+ + I A D M G D T+
Sbjct: 418 KKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDVVTY 477

Query: 385 RALCFGLKNAKR 420
L GL A R
Sbjct: 478 GTLINGLCKAGR 489



Score = 62.4 bits (150), Expect = 1e-08
Identities = 38/130 (29%), Positives = 61/130 (46%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M GC VT N LI+ + K G E + + A G PD TY++ ++GL ++
Sbjct: 150 MLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQEIADGFEPDQITYNTFVNGLCQNDH 209

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
V A++V + + G V N ++ L ++ ++++A N+M GC PD TF
Sbjct: 210 VGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNT 269

Query: 391 LCFGLKNAKR 420
L L R
Sbjct: 270 LIAALCTGNR 279



Score = 52.8 bits (125), Expect = 1e-05
Identities = 31/120 (25%), Positives = 56/120 (46%)
Frame = +1

Query: 43 GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTA 222
G + + V +N L++ + +L + +EM ARG PD T+++L+ L R+ V+TA
Sbjct: 49 GIQADTVVYNHLLNVLVEGSKMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTA 108

Query: 223 IEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFG 402
+ + ++ G +++ V + I+ AL M + GCS T L G
Sbjct: 109 VLMLEEMSSRGVAPDETTFTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLING 168


>tr|A2XJ76|A2XJ76_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_12495 PE=4 SV=1
Length = 742

Score = 91.7 bits (226), Expect = 2e-17
Identities = 45/124 (36%), Positives = 72/124 (58%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+EM+NSGC P+ VT+NTLI G L+ +ME+ GC TY+++IDGL +
Sbjct: 414 FEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLKDMESTGCPRSTITYNTIIDGLCK 473

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
++ A EVF+Q+ + G N++I L +D +IDDA + N+M G P++ T
Sbjct: 474 KMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCKDKKIDDAFELINQMISEGLQPNNIT 533

Query: 382 FRAL 393
+ ++
Sbjct: 534 YNSI 537



Score = 80.5 bits (197), Expect = 4e-14
Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 4/138 (2%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+++ + +M + G +PN +T+N+++ + K G + ++ M A G D TY +
Sbjct: 512 IDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDVVTYGT 571

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+GL ++G Q A++V +++ G T N ++ L R N I DAL F EM + G
Sbjct: 572 LINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLFREMAEVG 631

Query: 361 CSPDDWT----FRALCFG 402
PD T FR LC G
Sbjct: 632 EPPDALTYKIVFRGLCRG 649



Score = 78.6 bits (192), Expect = 2e-13
Identities = 47/140 (33%), Positives = 72/140 (51%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE +++ G P+ TFN LI+A K G L +L EM+ GC PD TY++
Sbjct: 372 LEEALDLARQVTVKGVSPDVYTFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNT 431

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID L G + A+++ ++ G + N+II L + RI++A + F++M G
Sbjct: 432 LIDNLCSLGKLGKALDLLKDMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQG 491

Query: 361 CSPDDWTFRALCFGLKNAKR 420
S + TF L GL K+
Sbjct: 492 ISRNAITFNTLIDGLCKDKK 511



Score = 73.9 bits (180), Expect = 4e-12
Identities = 38/131 (29%), Positives = 69/131 (52%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+E+ Y Q+ G EP+ +T+NT ++ + K+M+ M G PD +TY+
Sbjct: 267 VEDALGYIQQEIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNI 326

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+++ L ++G ++ A + NQ+ G + N++I L NR+++ALD ++ G
Sbjct: 327 VVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKG 386

Query: 361 CSPDDWTFRAL 393
SPD +TF L
Sbjct: 387 VSPDVYTFNIL 397



Score = 71.6 bits (174), Expect = 2e-11
Identities = 39/128 (30%), Positives = 63/128 (49%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
+ EM G +P+ VTFNTL+ A +A ++ EM +RG PD T+++L+ G
Sbjct: 169 YSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVIMLEEMSSRGVAPDETTFTTLMQGFVE 228

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
GS++ A+ V ++ +G T N +I + R++DAL + G PD T
Sbjct: 229 EGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQEIADGFEPDQIT 288

Query: 382 FRALCFGL 405
+ GL
Sbjct: 289 YNTFVNGL 296



Score = 71.2 bits (173), Expect = 3e-11
Identities = 41/135 (30%), Positives = 62/135 (45%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE +M + GC P+ TFNTLI A E L ++ +G PD YT++
Sbjct: 337 LEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVYTFNI 396

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI+ L + G A+ +F ++K G N++I L ++ ALD +M G
Sbjct: 397 LINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLKDMESTG 456

Query: 361 CSPDDWTFRALCFGL 405
C T+ + GL
Sbjct: 457 CPRSTITYNTIIDGL 471



Score = 68.9 bits (167), Expect = 1e-10
Identities = 38/121 (31%), Positives = 61/121 (50%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M G +P+ T+N +++ K G E ++N+M RGC PD T+++LI L
Sbjct: 312 MVQEGHDPDVFTYNIVVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNR 371

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
++ A+++ Q+ V G V N +I L + AL F EM GC+PD+ T+
Sbjct: 372 LEEALDLARQVTVKGVSPDVYTFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNT 431

Query: 391 L 393
L
Sbjct: 432 L 432



Score = 63.2 bits (152), Expect = 7e-09
Identities = 38/132 (28%), Positives = 63/132 (47%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
++ME++GC + +T+NT+I K E ++ ++M+ +G + T+++LIDGL +
Sbjct: 450 KDMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCKD 509

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
+ A E+ NQ+ G NSI+ + I A D M G D T+
Sbjct: 510 KKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDVVTY 569

Query: 385 RALCFGLKNAKR 420
L GL A R
Sbjct: 570 GTLINGLCKAGR 581



Score = 62.4 bits (150), Expect = 1e-08
Identities = 38/130 (29%), Positives = 61/130 (46%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M GC VT N LI+ + K G E + + A G PD TY++ ++GL ++
Sbjct: 242 MLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQEIADGFEPDQITYNTFVNGLCQNDH 301

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
V A++V + + G V N ++ L ++ ++++A N+M GC PD TF
Sbjct: 302 VGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKNGQLEEAKGILNQMVDRGCLPDITTFNT 361

Query: 391 LCFGLKNAKR 420
L L R
Sbjct: 362 LIAALCTGNR 371



Score = 52.8 bits (125), Expect = 1e-05
Identities = 31/120 (25%), Positives = 56/120 (46%)
Frame = +1

Query: 43 GCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTA 222
G + + V +N L++ + +L + +EM ARG PD T+++L+ L R+ V+TA
Sbjct: 141 GIQADTVVYNHLLNVLVEGSKMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTA 200

Query: 223 IEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFG 402
+ + ++ G +++ V + I+ AL M + GCS T L G
Sbjct: 201 VIMLEEMSSRGVAPDETTFTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLING 260



Score = 33.5 bits (75), Expect = 6.1
Identities = 31/123 (25%), Positives = 47/123 (38%), Gaps = 2/123 (1%)
Frame = +1

Query: 52 PNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTAIE- 228
P + +I G +L L+ EM G S +D A++
Sbjct: 72 PGPEVYEEIIRKLGAVGALDLMKVLVAEMRREGHQVKLGVVHSFLDSYEGQQLFDDAVDL 131

Query: 229 VFNQLKVL-GTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFGL 405
+ NQL+ L G V N ++ VLV +++ ++EM G PD TF L L
Sbjct: 132 ILNQLQPLFGIQADTVVYNHLLNVLVEGSKMKLLESVYSEMGARGIKPDVVTFNTLMKAL 191

Query: 406 KNA 414
A
Sbjct: 192 CRA 194


>tr|A9S042|A9S042_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_162062 PE=4 SV=1
Length = 1043

Score = 90.9 bits (224), Expect = 3e-17
Identities = 45/131 (34%), Positives = 72/131 (54%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E +F M+N C PN VT+ TL++ AKAG E ++ EM+ C PD Y++
Sbjct: 338 IDEACKFFNGMKNLRCSPNVVTYTTLVNGLAKAGRLEEACEVFVEMKENNCSPDAIAYNT 397

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LIDGLG++G A +F ++K G + N +I VL + R +A F+++ + G
Sbjct: 398 LIDGLGKAGEADMACGLFKEMKDRGLVPNLRTYNIMISVLGKAGRQPEAWQLFHDLKEQG 457

Query: 361 CSPDDWTFRAL 393
PD +T+ L
Sbjct: 458 AVPDVFTYNTL 468



Score = 89.7 bits (221), Expect = 7e-17
Identities = 48/140 (34%), Positives = 79/140 (56%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L+E + +EME GCEP+ VT+++L+ +F K E + L +EM +GC D TYS
Sbjct: 579 LDEAVSLLREMEKQGCEPSVVTYSSLMASFYKRDQEEESLSLFDEMVRKGCVADVSTYSL 638

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+I+ L +S V A++VF ++K G + +++ LV+D +ID AL FNE+ +
Sbjct: 639 VINCLCKSDDVDQALDVFGRMKEEGMEPLLGNYKTLLSSLVKDEKIDFALQIFNELQESS 698

Query: 361 CSPDDWTFRALCFGLKNAKR 420
PD + + + GL + R
Sbjct: 699 LVPDTFVYNIMVNGLVKSNR 718



Score = 88.6 bits (218), Expect = 2e-16
Identities = 47/124 (37%), Positives = 69/124 (55%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+EM+ C PN VT+N L+ AKAG + KL+ EME GC PD TY+ LIDG+G+
Sbjct: 866 FEEMQRRQCPPNIVTYNNLLSGLAKAGRLNVAEKLLEEMEKVGCVPDLVTYNILIDGVGK 925

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
G V A F ++K G V S+I L + +++ +A + F+ M + G +P T
Sbjct: 926 MGMVDEAESYFKRMKEKGIVPDVITFTSLIESLGKVDKLLEACELFDSMEEEGYNPSVVT 985

Query: 382 FRAL 393
+ L
Sbjct: 986 YNVL 989



Score = 80.9 bits (198), Expect = 3e-14
Identities = 40/131 (30%), Positives = 72/131 (54%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE Y +F+ + GC PN +++LI +F K GM + +L EM+ R C P+ TY++
Sbjct: 824 VEEAYYFFENSISKGCTPNVGVYSSLIDSFGKKGMVDRALELFEEMQRRQCPPNIVTYNN 883

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L+ GL ++G + A ++ +++ +G + N +I + + +D+A F M + G
Sbjct: 884 LLSGLAKAGRLNVAEKLLEEMEKVGCVPDLVTYNILIDGVGKMGMVDEAESYFKRMKEKG 943

Query: 361 CSPDDWTFRAL 393
PD TF +L
Sbjct: 944 IVPDVITFTSL 954



Score = 79.7 bits (195), Expect = 7e-14
Identities = 48/140 (34%), Positives = 66/140 (47%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE + F +M G EP+ V + +L+ K G + M + C PD TYSS
Sbjct: 754 LEEAFNMFTKMTEEGHEPDVVAYTSLMDVLGKGGKLSHALIIFRAMAKKRCVPDVVTYSS 813

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID LG+ G V+ A F G V V +S+I + +D AL+ F EM +
Sbjct: 814 LIDSLGKEGRVEEAYYFFENSISKGCTPNVGVYSSLIDSFGKKGMVDRALELFEEMQRRQ 873

Query: 361 CSPDDWTFRALCFGLKNAKR 420
C P+ T+ L GL A R
Sbjct: 874 CPPNIVTYNNLLSGLAKAGR 893



Score = 79.0 bits (193), Expect = 1e-13
Identities = 42/119 (35%), Positives = 64/119 (53%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
+EME GC P+ VT+N LI K GM + M+ +G PD T++SLI+ LG+
Sbjct: 902 EEMEKVGCVPDLVTYNILIDGVGKMGMVDEAESYFKRMKEKGIVPDVITFTSLIESLGKV 961

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
+ A E+F+ ++ G +V N +I +L R ++ +A F+EM GC PD T
Sbjct: 962 DKLLEACELFDSMEEEGYNPSVVTYNVLIDILGRAGKVHEAAMIFHEMKVKGCMPDGIT 1020



Score = 78.6 bits (192), Expect = 2e-13
Identities = 44/120 (36%), Positives = 66/120 (55%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE F EM+ + C P+A+ +NTLI KAG A++ L EM+ RG P+ TY+
Sbjct: 373 LEEACEVFVEMKENNCSPDAIAYNTLIDGLGKAGEADMACGLFKEMKDRGLVPNLRTYNI 432

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
+I LG++G A ++F+ LK G V N++I VL + ++D L EM + G
Sbjct: 433 MISVLGKAGRQPEAWQLFHDLKEQGAVPDVFTYNTLIDVLGKGGQMDKVLAIIKEMVEKG 492



Score = 73.9 bits (180), Expect = 4e-12
Identities = 40/135 (29%), Positives = 65/135 (48%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
L F+ M C P+ VT+++LI + K G E ++GC P+ YSS
Sbjct: 789 LSHALIIFRAMAKKRCVPDVVTYSSLIDSLGKEGRVEEAYYFFENSISKGCTPNVGVYSS 848

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID G+ G V A+E+F +++ + N+++ L + R++ A EM + G
Sbjct: 849 LIDSFGKKGMVDRALELFEEMQRRQCPPNIVTYNNLLSGLAKAGRLNVAEKLLEEMEKVG 908

Query: 361 CSPDDWTFRALCFGL 405
C PD T+ L G+
Sbjct: 909 CVPDLVTYNILIDGV 923



Score = 72.0 bits (175), Expect = 2e-11
Identities = 38/122 (31%), Positives = 65/122 (53%)
Frame = +1

Query: 49 EPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTAIE 228
+P+A TF +H+F ++G + + + EM G P +T++ LID L +SG++ A +
Sbjct: 284 QPDAQTFRIFVHSFNRSGRLDPAAEPIQEMIKSGIDPGVHTFTVLIDALVKSGNIDEACK 343

Query: 229 VFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFGLK 408
FN +K L V +++ L + R+++A + F EM + CSPD + L GL
Sbjct: 344 FFNGMKNLRCSPNVVTYTTLVNGLAKAGRLEEACEVFVEMKENNCSPDAIAYNTLIDGLG 403

Query: 409 NA 414
A
Sbjct: 404 KA 405



Score = 71.6 bits (174), Expect = 2e-11
Identities = 37/124 (29%), Positives = 67/124 (54%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F E++ S P+ +N +++ K+ + KL++ M+ + PD +TY+SL+DGLG+
Sbjct: 691 FNELQESSLVPDTFVYNIMVNGLVKSNRVDEACKLVDSMKNQNILPDLFTYTSLLDGLGK 750

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
SG ++ A +F ++ G V S++ VL + ++ AL F M + C PD T
Sbjct: 751 SGRLEEAFNMFTKMTEEGHEPDVVAYTSLMDVLGKGGKLSHALIIFRAMAKKRCVPDVVT 810

Query: 382 FRAL 393
+ +L
Sbjct: 811 YSSL 814



Score = 70.9 bits (172), Expect = 3e-11
Identities = 36/123 (29%), Positives = 61/123 (49%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E + M+ C P VT+ TL+ KAG + L+ EME +GC P TYSS
Sbjct: 544 VDEAVKLLEVMKKHECIPTVVTYTTLVDGLGKAGRLDEAVSLLREMEKQGCEPSVVTYSS 603

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L+ + + ++ +F+++ G V+ + +I L + + +D ALD F M + G
Sbjct: 604 LMASFYKRDQEEESLSLFDEMVRKGCVADVSTYSLVINCLCKSDDVDQALDVFGRMKEEG 663

Query: 361 CSP 369
P
Sbjct: 664 MEP 666



Score = 69.3 bits (168), Expect = 1e-10
Identities = 43/132 (32%), Positives = 64/132 (48%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
QEM SG +P TF LI A K+G + K N M+ C P+ TY++L++GL ++
Sbjct: 311 QEMIKSGIDPGVHTFTVLIDALVKSGNIDEACKFFNGMKNLRCSPNVVTYTTLVNGLAKA 370

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
G ++ A EVF ++K N++I L + D A F EM G P+ T+
Sbjct: 371 GRLEEACEVFVEMKENNCSPDAIAYNTLIDGLGKAGEADMACGLFKEMKDRGLVPNLRTY 430

Query: 385 RALCFGLKNAKR 420
+ L A R
Sbjct: 431 NIMISVLGKAGR 442



Score = 65.5 bits (158), Expect = 1e-09
Identities = 32/108 (29%), Positives = 62/108 (57%)
Frame = +1

Query: 61 VTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSVQTAIEVFNQ 240
+T+NTL+ AF G + KL+ M+ C P TY++L+DGLG++G + A+ + +
Sbjct: 529 ITYNTLMSAFIHNGHVDEAVKLLEVMKKHECIPTVVTYTTLVDGLGKAGRLDEAVSLLRE 588

Query: 241 LKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
++ G +V +S++ + ++ +++L F+EM + GC D T+
Sbjct: 589 MEKQGCEPSVVTYSSLMASFYKRDQEEESLSLFDEMVRKGCVADVSTY 636



Score = 64.7 bits (156), Expect = 2e-09
Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 3/102 (2%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E +YF+ M+ G P+ +TF +LI + K +L + ME G P TY+
Sbjct: 929 VDEAESYFKRMKEKGIVPDVITFTSLIESLGKVDKLLEACELFDSMEEEGYNPSVVTYNV 988

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTC---LTVAVCNSIICV 297
LID LGR+G V A +F+++KV G +T+ + I+ V
Sbjct: 989 LIDILGRAGKVHEAAMIFHEMKVKGCMPDGITIGIMKRILSV 1030



Score = 59.7 bits (143), Expect = 8e-08
Identities = 36/138 (26%), Positives = 64/138 (46%), Gaps = 2/138 (1%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
++E M+N P+ T+ +L+ K+G E + +M G PD Y+S
Sbjct: 719 VDEACKLVDSMKNQNILPDLFTYTSLLDGLGKSGRLEEAFNMFTKMTEEGHEPDVVAYTS 778

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
L+D LG+ G + A+ +F + V +S+I L ++ R+++A F G
Sbjct: 779 LMDVLGKGGKLSHALIIFRAMAKKRCVPDVVTYSSLIDSLGKEGRVEEAYYFFENSISKG 838

Query: 361 CSPDDWTFRAL--CFGLK 408
C+P+ + +L FG K
Sbjct: 839 CTPNVGVYSSLIDSFGKK 856



Score = 58.9 bits (141), Expect = 1e-07
Identities = 38/164 (23%), Positives = 68/164 (41%), Gaps = 31/164 (18%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+EM++ G PN T+N +I KAG +L ++++ +G PD +TY++LID LG+
Sbjct: 415 FKEMKDRGLVPNLRTYNIMISVLGKAGRQPEAWQLFHDLKEQGAVPDVFTYNTLIDVLGK 474

Query: 202 SGSVQTAIEVFNQLKVLG-------------------------------TCLTVAVCNSI 288
G + + + ++ G L N++
Sbjct: 475 GGQMDKVLAIIKEMVEKGGECIISRDSNAGHEGTIEGADRTVEYPSLGFKSLGEITYNTL 534

Query: 289 ICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRALCFGLKNAKR 420
+ + + +D+A+ M + C P T+ L GL A R
Sbjct: 535 MSAFIHNGHVDEAVKLLEVMKKHECIPTVVTYTTLVDGLGKAGR 578



Score = 58.5 bits (140), Expect = 2e-07
Identities = 36/133 (27%), Positives = 56/133 (42%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F +M++ GC P+ +N ++ K G + ++ PD T+ + R
Sbjct: 240 FNQMKSFGCNPSTNMYNFVLELLVKGGFYHSAVIVFGKLGQFRIQPDAQTFRIFVHSFNR 299

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
SG + A E ++ G V +I LV+ ID+A FN M CSP+ T
Sbjct: 300 SGRLDPAAEPIQEMIKSGIDPGVHTFTVLIDALVKSGNIDEACKFFNGMKNLRCSPNVVT 359

Query: 382 FRALCFGLKNAKR 420
+ L GL A R
Sbjct: 360 YTTLVNGLAKAGR 372



Score = 50.4 bits (119), Expect = 5e-05
Identities = 37/160 (23%), Positives = 65/160 (40%), Gaps = 31/160 (19%)
Frame = +1

Query: 7 EGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARG--C--------- 153
E + F +++ G P+ T+NTLI K G + ++ EM +G C
Sbjct: 445 EAWQLFHDLKEQGAVPDVFTYNTLIDVLGKGGQMDKVLAIIKEMVEKGGECIISRDSNAG 504

Query: 154 ------GPD--------------PYTYSSLIDGLGRSGSVQTAIEVFNQLKVLGTCLTVA 273
G D TY++L+ +G V A+++ +K TV
Sbjct: 505 HEGTIEGADRTVEYPSLGFKSLGEITYNTLMSAFIHNGHVDEAVKLLEVMKKHECIPTVV 564

Query: 274 VCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRAL 393
+++ L + R+D+A+ EM + GC P T+ +L
Sbjct: 565 TYTTLVDGLGKAGRLDEAVSLLREMEKQGCEPSVVTYSSL 604



Score = 48.5 bits (114), Expect = 2e-04
Identities = 31/129 (24%), Positives = 56/129 (43%)
Frame = +1

Query: 34 ENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSV 213
+ G T+ +I A A + +++ M G + +SL+ G + +V
Sbjct: 174 QQDGYSHTVGTYTLMIKRLAGAQETDAVVQILTAMWKEGHRISMHLLTSLLRTFGSTNNV 233

Query: 214 QTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRAL 393
A+E+FNQ+K G + + N ++ +LV+ A+ F ++ QF PD TFR
Sbjct: 234 SGALEIFNQMKSFGCNPSTNMYNFVLELLVKGGFYHSAVIVFGKLGQFRIQPDAQTFRIF 293

Query: 394 CFGLKNAKR 420
+ R
Sbjct: 294 VHSFNRSGR 302


>tr|A7PSR1|A7PSR1_VITVI Chromosome chr8 scaffold_29, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023048001
PE=4 SV=1
Length = 772

Score = 90.9 bits (224), Expect = 3e-17
Identities = 51/140 (36%), Positives = 73/140 (52%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
LEE + +EME+SGC N VT+NTLI F K E ++ +EME +G + TY++
Sbjct: 472 LEEALSLLKEMESSGCSRNVVTYNTLIDGFCKNKRIEEAEEIFDEMELQGISRNVVTYNT 531

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LIDGL ++ V+ A ++ +Q+ + G NS++ R I A D M G
Sbjct: 532 LIDGLCKNRRVEEAAQLMDQMLMEGLKPDKFTYNSLLTYFCRAGDIKKAADIVQTMTSNG 591

Query: 361 CSPDDWTFRALCFGLKNAKR 420
C PD T+ L GL A R
Sbjct: 592 CEPDSVTYGTLILGLSKAGR 611



Score = 87.0 bits (214), Expect = 5e-16
Identities = 40/124 (32%), Positives = 72/124 (58%)
Frame = +1

Query: 22 FQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGR 201
F+EM+ GC P+ T+N LI + G E L+ EME+ GC + TY++LIDG +
Sbjct: 444 FEEMKTKGCHPDEFTYNMLIDSLCSRGRLEEALSLLKEMESSGCSRNVVTYNTLIDGFCK 503

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
+ ++ A E+F+++++ G V N++I L ++ R+++A ++M G PD +T
Sbjct: 504 NKRIEEAEEIFDEMELQGISRNVVTYNTLIDGLCKNRRVEEAAQLMDQMLMEGLKPDKFT 563

Query: 382 FRAL 393
+ +L
Sbjct: 564 YNSL 567



Score = 83.2 bits (204), Expect = 7e-15
Identities = 42/135 (31%), Positives = 74/135 (54%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE ++ EM N G P+ TFN+L++ + G + ++++ M G PD +TY+S
Sbjct: 297 IEEVLSFIDEMSNEGFRPDRFTFNSLVNGLCRIGHVKHALEILDVMLQEGFDPDIFTYNS 356

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI GL + G V+ A+E+ NQ+ + N++I L ++N++++A + + G
Sbjct: 357 LIFGLCKLGEVEEAVEILNQMILRDFSPNTVTYNTLISTLCKENQVEEATELARVLTSKG 416

Query: 361 CSPDDWTFRALCFGL 405
PD TF +L GL
Sbjct: 417 ILPDVCTFNSLIQGL 431



Score = 79.0 bits (193), Expect = 1e-13
Identities = 45/138 (32%), Positives = 70/138 (50%), Gaps = 4/138 (2%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE +M G +P+ T+N+L+ F +AG + ++ M + GC PD TY +
Sbjct: 542 VEEAAQLMDQMLMEGLKPDKFTYNSLLTYFCRAGDIKKAADIVQTMTSNGCEPDSVTYGT 601

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI GL ++G V+ A + +++ G L N +I L R+ R +A+ F EM + G
Sbjct: 602 LILGLSKAGRVELASRLLRTVQLKGMVLAPQTYNPVIKALFREKRTSEAVRLFREMMEKG 661

Query: 361 CSPDDWT----FRALCFG 402
PD T FR LC G
Sbjct: 662 DPPDAVTYKVVFRGLCSG 679



Score = 75.5 bits (184), Expect = 1e-12
Identities = 42/140 (30%), Positives = 71/140 (50%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE + + + G P+ TFN+LI L +L EM+ +GC PD +TY+
Sbjct: 402 VEEATELARVLTSKGILPDVCTFNSLIQGLCLTNNHRLAMELFEEMKTKGCHPDEFTYNM 461

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LID L G ++ A+ + +++ G V N++I ++ RI++A + F+EM G
Sbjct: 462 LIDSLCSRGRLEEALSLLKEMESSGCSRNVVTYNTLIDGFCKNKRIEEAEEIFDEMELQG 521

Query: 361 CSPDDWTFRALCFGLKNAKR 420
S + T+ L GL +R
Sbjct: 522 ISRNVVTYNTLIDGLCKNRR 541



Score = 71.2 bits (173), Expect = 3e-11
Identities = 38/123 (30%), Positives = 67/123 (54%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRS 204
++M +GC + VT N L+H + K G E ++EM G PD +T++SL++GL R
Sbjct: 270 EQMVAAGCPSSNVTVNVLVHGYCKEGRIEEVLSFIDEMSNEGFRPDRFTFNSLVNGLCRI 329

Query: 205 GSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTF 384
G V+ A+E+ + + G + NS+I L + +++A++ N+M SP+ T+
Sbjct: 330 GHVKHALEILDVMLQEGFDPDIFTYNSLIFGLCKLGEVEEAVEILNQMILRDFSPNTVTY 389

Query: 385 RAL 393
L
Sbjct: 390 NTL 392



Score = 71.2 bits (173), Expect = 3e-11
Identities = 44/140 (31%), Positives = 66/140 (47%)
Frame = +1

Query: 1 LEEGYAYFQEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSS 180
+EE +M PN VT+NTLI K E +L + ++G PD T++S
Sbjct: 367 VEEAVEILNQMILRDFSPNTVTYNTLISTLCKENQVEEATELARVLTSKGILPDVCTFNS 426

Query: 181 LIDGLGRSGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFG 360
LI GL + + + A+E+F ++K G N +I L R+++AL EM G
Sbjct: 427 LIQGLCLTNNHRLAMELFEEMKTKGCHPDEFTYNMLIDSLCSRGRLEEALSLLKEMESSG 486

Query: 361 CSPDDWTFRALCFGLKNAKR 420
CS + T+ L G KR
Sbjct: 487 CSRNVVTYNTLIDGFCKNKR 506



Score = 67.0 bits (162), Expect = 5e-10
Identities = 37/125 (29%), Positives = 62/125 (49%)
Frame = +1

Query: 31 MENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGS 210
M + G +P+ TFN LI A +A +M EM + G PD T+++L+ G G+
Sbjct: 202 MVSRGIKPDVTTFNILIKALCRAHQIRPAILMMEEMGSYGLSPDEKTFTTLMQGFIEEGN 261

Query: 211 VQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRA 390
+ A+ + Q+ G + N ++ ++ RI++ L +EM G PD +TF +
Sbjct: 262 MNGALRIREQMVAAGCPSSNVTVNVLVHGYCKEGRIEEVLSFIDEMSNEGFRPDRFTFNS 321

Query: 391 LCFGL 405
L GL
Sbjct: 322 LVNGL 326



Score = 53.9 bits (128), Expect = 4e-06
Identities = 39/127 (30%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
Frame = +1

Query: 25 QEMENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEAR-GCGPDPYTYSSLIDGLGR 201
QEM+++GCE TF LI ++AK + + +++ ME G D +TY+ L++ L
Sbjct: 129 QEMKHTGCEIRRGTFLILIESYAKFELFDEAVAVVDIMEEEFGLKLDAFTYNFLLNVLVD 188

Query: 202 SGSVQTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWT 381
++ V +++ G V N +I L R ++I A+ EM +G SPD+ T
Sbjct: 189 GNKLKLVEIVNSRMVSRGIKPDVTTFNILIKALCRAHQIRPAILMMEEMGSYGLSPDEKT 248

Query: 382 FRALCFG 402
F L G
Sbjct: 249 FTTLMQG 255



Score = 43.9 bits (102), Expect = 0.005
Identities = 28/123 (22%), Positives = 54/123 (43%)
Frame = +1

Query: 34 ENSGCEPNAVTFNTLIHAFAKAGMAELTNKLMNEMEARGCGPDPYTYSSLIDGLGRSGSV 213
E G + +A T+N L++ +L + + M +RG PD T++ LI L R+ +
Sbjct: 168 EEFGLKLDAFTYNFLLNVLVDGNKLKLVEIVNSRMVSRGIKPDVTTFNILIKALCRAHQI 227

Query: 214 QTAIEVFNQLKVLGTCLTVAVCNSIICVLVRDNRIDDALDCFNEMPQFGCSPDDWTFRAL 393
+ AI + ++ G +++ + + ++ AL +M GC + T L
Sbjct: 228 RPAILMMEEMGSYGLSPDEKTFTTLMQGFIEEGNMNGALRIREQMVAAGCPSSNVTVNVL 287

Query: 394 CFG 402
G
Sbjct: 288 VHG 290