BP914272
Clone id YMU001_000057_A09
Library
Length 561
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTTTTTGAGTATCAAAAAGATAATCACCCTTGCCAAAAAGAATAGAGGAC
TGAATTCATTGCTCCTCTCTTCTGTACAAATCTTAACCACTTTTCTAGCACATTCATTAA
CCATGCTAGTAAGTGTACATATATCCCACTAGCTCTGCCAACTATATATCCAACCATTTA
CATAGTAGAGGATTCAGTCTACAATGAGCGTCCTCTTCATCATTTCATCTCTGACGGGAT
AGCTAGAGTGCTCACGTGATGGCAAAGTATATTAGCCTGCAGTTTCATGCAGCCAATGAG
GGTATGTTTGCAAGGGTGCAGTATATATAGGAAGCGCATCTTCATCTTTGCCAATCTTAC
GACAAGAACACTTCCACATTCGCACTTTTCAAAGAGCTACACACAGGACACCTCTCACAC
TCGTCCTTGCATGCCACACAAAGGCAAAGATGCAAGCAAGGTAACAGAACAACCGATGCC
TCCTTCGCCTTGCACCTTCGGCAAGCCCGCATCACTGCAACCTCATTGTCATACATAATG
CTCGATTGAGGAGTACTCTTC
■■Homology search results ■■ -
sp_hit_id Q91VN0
Definition sp|Q91VN0|LRP5_MOUSE Low-density lipoprotein receptor-related protein 5 OS=Mus musculus
Align length 153
Score (bit) 32.3
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914272|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_A09.
(545 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q91VN0|LRP5_MOUSE Low-density lipoprotein receptor-related pr... 32 1.5
sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein ... 32 2.0
sp|Q13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein ... 32 2.0
sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gal... 31 4.4
sp|O62640|PIAP_PIG Putative inhibitor of apoptosis OS=Sus scrofa... 30 5.8
sp|A1E2V0|BIRC3_CANFA Baculoviral IAP repeat-containing protein ... 30 5.8
sp|Q8BQ33|CO042_MOUSE Uncharacterized protein C15orf42 homolog O... 30 7.6
sp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein ... 30 9.9
sp|Q7N2G9|ASTD_PHOLL N-succinylglutamate 5-semialdehyde dehydrog... 30 9.9

>sp|Q91VN0|LRP5_MOUSE Low-density lipoprotein receptor-related protein
5 OS=Mus musculus GN=Lrp5 PE=2 SV=2
Length = 1614

Score = 32.3 bits (72), Expect = 1.5
Identities = 42/153 (27%), Positives = 62/153 (40%), Gaps = 12/153 (7%)
Frame = +1

Query: 58 PLFCTNLNHFSSTFINHASKCTYIPLAL-----PTIYPTIYIVEDSVYNE------RPLH 204
PL+ N +S+ + ++K T P L P P++Y V D Y+ RP
Sbjct: 1470 PLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNV-DVFYSSGIPATARPYR 1528

Query: 205 HFISDGIARVLT*WQSILACSFMQPMRVCLQGCSIYR-KRIFIFANLTTRTLPHSHFSKS 381
++ G+A T CS VC SI R K + +L + + P+
Sbjct: 1529 PYVIRGMAPPTT------PCS----TDVCDSDYSISRWKSSKYYLDLNSDSDPYPPPPTP 1578

Query: 382 YTQDTSHTRPCMPHKGKDASKVTEQPMPPSPCT 480
++Q S C P G + S P PPSPCT
Sbjct: 1579 HSQYLSAEDSCPPSPGTERSYCHLFPPPPSPCT 1611


>sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3
OS=Homo sapiens GN=BIRC3 PE=1 SV=2
Length = 604

Score = 32.0 bits (71), Expect = 2.0
Identities = 15/50 (30%), Positives = 18/50 (36%)
Frame = -2

Query: 493 RACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
R C+ C KE S C +CP+C S V FLS
Sbjct: 555 RTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS 604


>sp|Q13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2
OS=Homo sapiens GN=BIRC2 PE=1 SV=2
Length = 618

Score = 32.0 bits (71), Expect = 2.0
Identities = 14/50 (28%), Positives = 18/50 (36%)
Frame = -2

Query: 493 RACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
R C+ C KE S C +CP+C + V FLS
Sbjct: 569 RTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS 618


>sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus
GN=ITA PE=2 SV=1
Length = 611

Score = 30.8 bits (68), Expect = 4.4
Identities = 14/50 (28%), Positives = 17/50 (34%)
Frame = -2

Query: 493 RACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
R C+ C KE S C +CP+C V FLS
Sbjct: 562 RTCKVCMDKEVSIVFIPCGHLVVCKECAPSLRKCPICRGTIKGTVRTFLS 611


>sp|O62640|PIAP_PIG Putative inhibitor of apoptosis OS=Sus scrofa
GN=PIAP PE=2 SV=1
Length = 358

Score = 30.4 bits (67), Expect = 5.8
Identities = 14/50 (28%), Positives = 17/50 (34%)
Frame = -2

Query: 493 RACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
R C+ C KE S C +CP+C V FLS
Sbjct: 309 RTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTFLS 358


>sp|A1E2V0|BIRC3_CANFA Baculoviral IAP repeat-containing protein 3
OS=Canis familiaris GN=BIRC3 PE=2 SV=1
Length = 604

Score = 30.4 bits (67), Expect = 5.8
Identities = 14/50 (28%), Positives = 17/50 (34%)
Frame = -2

Query: 493 RACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
R C+ C KE S C +CP+C V FLS
Sbjct: 555 RTCKVCMDKEVSIVFIPCGHLVVCRDCAPSLRKCPICRGTVRGTVRTFLS 604


>sp|Q8BQ33|CO042_MOUSE Uncharacterized protein C15orf42 homolog
OS=Mus musculus PE=2 SV=2
Length = 1889

Score = 30.0 bits (66), Expect = 7.6
Identities = 11/31 (35%), Positives = 17/31 (54%)
Frame = -1

Query: 119 HLLAWLMNVLEKWLRFVQKRGAMNSVLYSFW 27
H +W ++EKW F GA + ++ SFW
Sbjct: 485 HTSSWSPALVEKWFPFSNASGATSDLMESFW 515


>sp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2
OS=Mus musculus GN=Birc2 PE=1 SV=1
Length = 612

Score = 29.6 bits (65), Expect = 9.9
Identities = 13/50 (26%), Positives = 17/50 (34%)
Frame = -2

Query: 493 RACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
R C+ C +E S C +CP+C V FLS
Sbjct: 563 RTCKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTFLS 612


>sp|Q7N2G9|ASTD_PHOLL N-succinylglutamate 5-semialdehyde
dehydrogenase OS=Photorhabdus luminescens subsp.
laumondii GN=astD PE=3 SV=1
Length = 491

Score = 29.6 bits (65), Expect = 9.9
Identities = 17/79 (21%), Positives = 35/79 (44%)
Frame = -3

Query: 423 VWHARTSVRGVLCVAL*KVRMWKCSCRKIGKDEDALPIYTAPLQTYPHWLHETAG*YTLP 244
+W RT ++ ++ A + W+ ++ G+ E +P A L+ PH + G Y P
Sbjct: 94 LWETRTEIQSMIGKAAISIEAWE---QRTGESETIMPDGRALLRHRPHGVMAVFGPYNFP 150

Query: 243 SREHSSYPVRDEMMKRTLI 187
+ + + + TL+
Sbjct: 151 GHLPNGHIIPALIAGNTLV 169


tr_hit_id Q7FAF5
Definition tr|Q7FAF5|Q7FAF5_ORYSJ Os04g0402500 protein OS=Oryza sativa subsp. japonica
Align length 57
Score (bit) 41.2
E-value 0.036
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914272|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_A09.
(545 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7FAF5|Q7FAF5_ORYSJ Os04g0402500 protein OS=Oryza sativa subs... 41 0.036
tr|A2XT15|A2XT15_ORYSI Putative uncharacterized protein OS=Oryza... 41 0.036
tr|A7QP01|A7QP01_VITVI Chromosome chr1 scaffold_135, whole genom... 40 0.081
tr|A5BWV5|A5BWV5_VITVI Putative uncharacterized protein (Fragmen... 40 0.081
tr|A9SWK7|A9SWK7_PHYPA Predicted protein OS=Physcomitrella paten... 40 0.11
tr|A9REL7|A9REL7_PHYPA Predicted protein (Fragment) OS=Physcomit... 39 0.18
tr|A7PWS0|A7PWS0_VITVI Chromosome chr19 scaffold_35, whole genom... 39 0.23
tr|A7PCY4|A7PCY4_VITVI Chromosome chr17 scaffold_12, whole genom... 39 0.23
tr|A5C5D6|A5C5D6_VITVI Putative uncharacterized protein OS=Vitis... 39 0.23
tr|A9RDP0|A9RDP0_PHYPA Predicted protein (Fragment) OS=Physcomit... 38 0.31
tr|A9T5Z3|A9T5Z3_PHYPA Predicted protein OS=Physcomitrella paten... 37 0.52
tr|Q6ZGA0|Q6ZGA0_ORYSJ Os02g0130300 protein OS=Oryza sativa subs... 37 0.68
tr|Q6ZG99|Q6ZG99_ORYSJ Putative S-ribonuclease binding protein S... 37 0.68
tr|A2X0I0|A2X0I0_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.68
tr|A7NSS1|A7NSS1_VITVI Chromosome chr18 scaffold_1, whole genome... 37 0.89
tr|A5B1D9|A5B1D9_VITVI Putative uncharacterized protein OS=Vitis... 37 0.89
tr|Q9SGY4|Q9SGY4_ARATH F20B24.9 OS=Arabidopsis thaliana PE=4 SV=1 36 1.2
tr|Q8LG46|Q8LG46_ARATH S-ribonuclease binding protein SBP1, puta... 36 1.2
tr|Q84JF9|Q84JF9_ARATH Putative S-ribonuclease binding protein S... 36 1.2
tr|Q56W92|Q56W92_ARATH At1g10650 protein OS=Arabidopsis thaliana... 36 1.2
tr|B3H4E5|B3H4E5_ARATH Uncharacterized protein At1g10650.2 OS=Ar... 36 1.2
tr|A7PCG7|A7PCG7_VITVI Chromosome chr2 scaffold_11, whole genome... 36 1.2
tr|Q7XSC9|Q7XSC9_ORYSJ Os04g0403200 protein OS=Oryza sativa subs... 35 2.0
tr|B8Q8A9|B8Q8A9_ORYSI SKIP interacting protein 23 (Fragment) OS... 35 2.0
tr|A9SEP3|A9SEP3_PHYPA Predicted protein (Fragment) OS=Physcomit... 35 2.0
tr|A2XT19|A2XT19_ORYSI Putative uncharacterized protein OS=Oryza... 35 2.0
tr|B6T955|B6T955_MAIZE CONSTANS interacting protein 4 OS=Zea may... 35 2.6
tr|B6T3H2|B6T3H2_MAIZE Inhibitor of apoptosis-like protein OS=Ze... 35 2.6
tr|B6STV7|B6STV7_MAIZE Inhibitor of apoptosis-like protein OS=Ze... 35 3.4
tr|Q9M5Q3|Q9M5Q3_PETHY S-ribonuclease binding protein SBP1 (Frag... 34 4.4

>tr|Q7FAF5|Q7FAF5_ORYSJ Os04g0402500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0118P14.2 PE=4 SV=1
Length = 316

Score = 41.2 bits (95), Expect = 0.036
Identities = 19/57 (33%), Positives = 29/57 (50%)
Frame = -2

Query: 514 DNEVAVMRACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
D V+ +C+ C+ EAS AC+ + CPVC++ K+A+V V LS
Sbjct: 260 DVAVSTATSCKACRVAEASVLLLPCRHLCLCGACEAAADACPVCAATKNASVHVLLS 316


>tr|A2XT15|A2XT15_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_15752 PE=4 SV=1
Length = 332

Score = 41.2 bits (95), Expect = 0.036
Identities = 19/57 (33%), Positives = 29/57 (50%)
Frame = -2

Query: 514 DNEVAVMRACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
D V+ +C+ C+ EAS AC+ + CPVC++ K+A+V V LS
Sbjct: 276 DVAVSTATSCKACRVAEASVLLLPCRHLCLCGACEAAADACPVCAATKNASVHVLLS 332


>tr|A7QP01|A7QP01_VITVI Chromosome chr1 scaffold_135, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002742001
PE=4 SV=1
Length = 353

Score = 40.0 bits (92), Expect = 0.081
Identities = 18/48 (37%), Positives = 24/48 (50%)
Frame = -2

Query: 487 CRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
CR CK+KE S C+ CPVC S+K+ V+V+LS
Sbjct: 306 CRACKSKEVSILLIPCRHLCICKECEGLISVCPVCQSMKTTGVQVYLS 353


>tr|A5BWV5|A5BWV5_VITVI Putative uncharacterized protein (Fragment)
OS=Vitis vinifera GN=VITISV_032504 PE=4 SV=1
Length = 346

Score = 40.0 bits (92), Expect = 0.081
Identities = 18/48 (37%), Positives = 24/48 (50%)
Frame = -2

Query: 487 CRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
CR CK+KE S C+ CPVC S+K+ V+V+LS
Sbjct: 299 CRACKSKEVSILLIPCRHLCICKECEGLISVCPVCQSMKTTGVQVYLS 346


>tr|A9SWK7|A9SWK7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_216435 PE=4 SV=1
Length = 268

Score = 39.7 bits (91), Expect = 0.11
Identities = 16/57 (28%), Positives = 29/57 (50%)
Frame = -2

Query: 514 DNEVAVMRACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
+ E+ R CR C+ + S C+ + CP+C +LK+A+V+V++S
Sbjct: 212 NRELREQRTCRSCRCNDVSILLLPCRHLCLCKDCEARLDVCPLCQTLKNASVQVYMS 268


>tr|A9REL7|A9REL7_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_201727 PE=4 SV=1
Length = 206

Score = 38.9 bits (89), Expect = 0.18
Identities = 15/56 (26%), Positives = 28/56 (50%)
Frame = -2

Query: 514 DNEVAVMRACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFL 347
+ E+ R CR C+ + S C+ + CP+C +LK+A+V+V++
Sbjct: 151 NRELREQRTCRSCRCNDVSILLLPCRHLCLCKDCEARLDACPLCQTLKNASVQVYM 206


>tr|A7PWS0|A7PWS0_VITVI Chromosome chr19 scaffold_35, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025741001
PE=4 SV=1
Length = 262

Score = 38.5 bits (88), Expect = 0.23
Identities = 19/51 (37%), Positives = 24/51 (47%)
Frame = -2

Query: 496 MRACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
MR CR C+ +EAS C CP+C S K+A+V V LS
Sbjct: 212 MRWCRNCRKEEASVLLLPCRHLCLCTICGSTLHTCPICKSNKNASVHVNLS 262


>tr|A7PCY4|A7PCY4_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016060001
PE=4 SV=1
Length = 364

Score = 38.5 bits (88), Expect = 0.23
Identities = 17/48 (35%), Positives = 26/48 (54%)
Frame = -2

Query: 487 CRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
CR CK +E S + C+ + CPVC +K+A+V+VF+S
Sbjct: 317 CRACKVREVSVLLLPCRHLCLCMDCEGFIDVCPVCRVMKTASVQVFMS 364


>tr|A5C5D6|A5C5D6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003762 PE=4 SV=1
Length = 360

Score = 38.5 bits (88), Expect = 0.23
Identities = 17/48 (35%), Positives = 26/48 (54%)
Frame = -2

Query: 487 CRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
CR CK +E S + C+ + CPVC +K+A+V+VF+S
Sbjct: 313 CRACKVREVSVLLLPCRHLCLCMDCEGFIDVCPVCXVMKTASVQVFMS 360


>tr|A9RDP0|A9RDP0_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_111957 PE=4 SV=1
Length = 246

Score = 38.1 bits (87), Expect = 0.31
Identities = 16/57 (28%), Positives = 28/57 (49%)
Frame = -2

Query: 514 DNEVAVMRACRRCKAKEASXXXXXXXXXXXXVACKDECERCPVCSSLKSANVEVFLS 344
+ E+ R CR C+ + S C+ + CP+C + K+A+V+VF+S
Sbjct: 190 NKELREQRTCRVCRCNDVSMLLLPCRHLCLCQDCEGQLHACPLCRTPKNASVQVFMS 246