BP914295
Clone id YMU001_000057_C09
Library
Length 557
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAAAGGTTTTGTATTGTGGATTAGAATTTTTTTGATTGCTGATTGCATGATGATTATTT
CAGCCATCAGATCTGATGTTTTGTTTTATGACAAGTTCCCTAAAAGGTTTTCTGGTATAG
CCGCAAATGCTTATAAAGCTGGCAACTTCTTCAAGTCTCTCCTGTATAGGGATTTCGAGG
AGATGTACAGAGATTCACTGCTCCACCTTGGTGTTTAATCTCCTGCCGTATTTCCAGTAA
GATGTATAGAGGCTTCTCTCTCCTTTTGACTATACCTCTTTTTCCTTCAGTCATGTTCGA
GATGACATGGCTGCTTACCCTTGGATCCACCTGTCTTTGGTTATGAAGGACTTTCCAACC
AAGCTAGTAAAAGTGCTAGGTGCTTATAAGAGAGTGCAGATTCAGTGCGGTAAGATTCTA
TTCAATGCTACAGAAGTCATTCCTTCTGGTGCCTTTCTTACATGAAAGTCATATTGGAGA
TTGGCACCTCAATTGTGTGGACTCTATTTTGGGCTTGTTATTTGGAACCCAGGGTGTTCA
TGCACCTGAGGTAGCAT
■■Homology search results ■■ -
sp_hit_id Q36150
Definition sp|Q36150|NU4M_TARSY NADH-ubiquinone oxidoreductase chain 4 (Fragment) OS=Tarsius syrichta
Align length 46
Score (bit) 32.7
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914295|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_C09.
(557 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q36150|NU4M_TARSY NADH-ubiquinone oxidoreductase chain 4 (Fra... 33 1.2
sp|P03238|E417_ADE02 Probable early E4 17 kDa protein OS=Human a... 30 6.1
sp|P0A4U8|DAPD_BORPE 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat... 30 8.0
sp|Q7W8Y2|DAPD_BORPA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat... 30 8.0
sp|P0A4U9|DAPD_BORBR 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat... 30 8.0

>sp|Q36150|NU4M_TARSY NADH-ubiquinone oxidoreductase chain 4
(Fragment) OS=Tarsius syrichta GN=MT-ND4 PE=3 SV=2
Length = 167

Score = 32.7 bits (73), Expect = 1.2
Identities = 12/46 (26%), Positives = 24/46 (52%)
Frame = +1

Query: 307 MAAYPWIHLSLVMKDFPTKLVKVLGAYKRVQIQCGKILFNATEVIP 444
MAA+ W HL++++ T + + Y + Q GK ++ ++P
Sbjct: 76 MAAFSWSHLTIILVGLNTLITALYSLYMLIMTQRGKYTYHINNIMP 121


>sp|P03238|E417_ADE02 Probable early E4 17 kDa protein OS=Human
adenovirus C serotype 2 PE=4 SV=1
Length = 153

Score = 30.4 bits (67), Expect = 6.1
Identities = 12/22 (54%), Positives = 18/22 (81%)
Frame = -1

Query: 269 SKGERSLYTSYWKYGRRLNTKV 204
S+GER++Y+ W+ G RLNT+V
Sbjct: 131 SRGERTVYSVCWEGGGRLNTRV 152


>sp|P0A4U8|DAPD_BORPE 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
N-succinyltransferase OS=Bordetella pertussis GN=dapD
PE=3 SV=1
Length = 273

Score = 30.0 bits (66), Expect = 8.0
Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +3

Query: 18 WIRIFLIADCMMIISAI--RSDVLFYDKFPKRFSGIAANAYKAGNF 149
WI+ ++ + +A+ + + FYDK P +F+G A+KAG +
Sbjct: 59 WIKKAVLLSFRLHDNAVMGQGPLQFYDKVPTKFAGYGEAAFKAGGY 104


>sp|Q7W8Y2|DAPD_BORPA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
N-succinyltransferase OS=Bordetella parapertussis
GN=dapD PE=3 SV=1
Length = 273

Score = 30.0 bits (66), Expect = 8.0
Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +3

Query: 18 WIRIFLIADCMMIISAI--RSDVLFYDKFPKRFSGIAANAYKAGNF 149
WI+ ++ + +A+ + + FYDK P +F+G A+KAG +
Sbjct: 59 WIKKAVLLSFRLHDNAVMGQGPLQFYDKVPTKFAGYGEAAFKAGGY 104


>sp|P0A4U9|DAPD_BORBR 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
N-succinyltransferase OS=Bordetella bronchiseptica
GN=dapD PE=3 SV=1
Length = 273

Score = 30.0 bits (66), Expect = 8.0
Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +3

Query: 18 WIRIFLIADCMMIISAI--RSDVLFYDKFPKRFSGIAANAYKAGNF 149
WI+ ++ + +A+ + + FYDK P +F+G A+KAG +
Sbjct: 59 WIKKAVLLSFRLHDNAVMGQGPLQFYDKVPTKFAGYGEAAFKAGGY 104


tr_hit_id B6QVK9
Definition tr|B6QVK9|B6QVK9_PENMA Putative uncharacterized protein OS=Penicillium marneffei ATCC 18224
Align length 33
Score (bit) 33.9
E-value 6.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914295|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_C09.
(557 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6QVK9|B6QVK9_PENMA Putative uncharacterized protein OS=Penic... 34 6.1

>tr|B6QVK9|B6QVK9_PENMA Putative uncharacterized protein
OS=Penicillium marneffei ATCC 18224 GN=PMAA_012830 PE=4
SV=1
Length = 788

Score = 33.9 bits (76), Expect = 6.1
Identities = 16/33 (48%), Positives = 21/33 (63%)
Frame = +1

Query: 265 FDYTSFSFSHVRDDMAAYPWIHLSLVMKDFPTK 363
F+Y SF F+H DD +AY W+ L KD PT+
Sbjct: 298 FEYLSFIFNHYADDGSAYSWL---LRFKDQPTE 327