BP914311
Clone id YMU001_000057_E04
Library
Length 618
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GATTAGACCCTAGATAAAGAGAAGAAACACCTTTGGGTCCCCATTACTGGCCCATGCAAG
CCACACAACCAACCACACCAACATACAAAAATCAGACCAATGAATAGGCTATCTGGGTGA
GCCAAACACCAATATACCTCAAGGAAAAGAGGCCAAAGGTTGCCACCATATGAGCAGGCT
CTACCATCACCACTCTTGTCTCCCTTCTACAAATATCCCCATGTAGTAAAGCATTCAAAA
TGACACCAAACCATCGTTGATGCGTTATTTAGGATCTAGAGAGGCAACCTCCACTAGCTC
AAAAATGAAAGGGTTTGGCAAAGAGAGACCGTCTAAACAGAGGAAGGAGCTACCGGTGTC
TCACCCTAGAGATCGCCTCCCTCTGCACATTATGCATCTCTAACCTCCAACATAAATTTC
ACGAACTCCACCCTGCCATAGCACTCTCCATACGTGCCCCGACAACATGGCCTTGCACAT
TGTAGAGTGACAAACGGAGGAGCTCCGGTGAACCCTATGAGTCTTCAATCCAAAAAACTC
TTTGATGAAATACTCACTTGCCCACAATCAAACAAACTTACAACTTCTCCTTTCAGCGTG
AATNTTGGAGCCAATAGT
■■Homology search results ■■ -
sp_hit_id Q93442
Definition sp|Q93442|MED13_CAEEL Mediator of RNA polymerase II transcription subunit 13 OS=Caenorhabditis elegans
Align length 66
Score (bit) 34.3
E-value 0.53
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914311|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_E04.
(618 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q93442|MED13_CAEEL Mediator of RNA polymerase II transcriptio... 34 0.53
sp|Q5SCY2|NU2C_HUPLU NAD(P)H-quinone oxidoreductase chain 2, chl... 32 2.6
sp|Q8C2B3|HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus GN=H... 31 4.5
sp|A2T377|NU2C_ANGEV NAD(P)H-quinone oxidoreductase chain 2, chl... 31 5.8
sp|Q62059|CSPG2_MOUSE Versican core protein OS=Mus musculus GN=V... 31 5.9
sp|O73630|NFKB2_XENLA Nuclear factor NF-kappa-B p100 subunit OS=... 30 7.7

>sp|Q93442|MED13_CAEEL Mediator of RNA polymerase II transcription
subunit 13 OS=Caenorhabditis elegans GN=let-19 PE=1 SV=3
Length = 2862

Score = 34.3 bits (77), Expect = 0.53
Identities = 18/66 (27%), Positives = 34/66 (51%)
Frame = +1

Query: 16 KEKKHLWVPITGPCKPHNQPHQHTKIRPMNRLSG*AKHQYTSRKRGQRLPPYEQALPSPL 195
K+K + W P G + H H + P N+++G + +Y + +++ YE LP+P
Sbjct: 740 KDKYNRWKP--GMSRAEKIEHAHYQFDPSNQMTG-SPREYHLKDLPKKIQKYESILPTPK 796

Query: 196 LSPFYK 213
+ F+K
Sbjct: 797 GNKFFK 802


>sp|Q5SCY2|NU2C_HUPLU NAD(P)H-quinone oxidoreductase chain 2,
chloroplastic OS=Huperzia lucidula GN=ndhB PE=3 SV=1
Length = 505

Score = 32.0 bits (71), Expect = 2.6
Identities = 12/24 (50%), Positives = 15/24 (62%)
Frame = -2

Query: 116 PDSLFIGLIFVCWCGWLCGLHGPV 45
P S F G +++ WCGW GLH V
Sbjct: 392 PLSGFFGKLYLFWCGWQAGLHSLV 415


>sp|Q8C2B3|HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus
GN=Hdac7 PE=1 SV=2
Length = 938

Score = 31.2 bits (69), Expect = 4.5
Identities = 29/69 (42%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
Frame = +1

Query: 10 LDKEKKH--LW-VPITGPCKPH-NQPHQHTKIRPMNRLSG*AKHQYTSRKRGQRLPPYEQ 177
LD H LW VP GP H QP T+ RLSG H+ +R R + LPP
Sbjct: 298 LDPSVSHAPLWTVPGLGPLPFHFAQPLLTTE-----RLSGSGLHRPLNRTRSEPLPP--S 350

Query: 178 ALPSPLLSP 204
A SPLL+P
Sbjct: 351 ATASPLLAP 359


>sp|A2T377|NU2C_ANGEV NAD(P)H-quinone oxidoreductase chain 2,
chloroplastic OS=Angiopteris evecta GN=ndhB1 PE=3 SV=1
Length = 494

Score = 30.8 bits (68), Expect = 5.8
Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 5/67 (7%)
Frame = -2

Query: 239 FECFTTWGYL*KGDKSGDGRACSYGGNLWPLFLEVYWCLAH-----PDSLFIGLIFVCWC 75
F C T +G D D S L L L + CL P S F G +++ WC
Sbjct: 348 FACITLFGLRTGTDNIRDYAGLSTKDPL--LTLSLVLCLLSLGGIPPLSGFFGKLYLFWC 405

Query: 74 GWLCGLH 54
GW GL+
Sbjct: 406 GWKAGLY 412


>sp|Q62059|CSPG2_MOUSE Versican core protein OS=Mus musculus GN=Vcan
PE=1 SV=2
Length = 3357

Score = 30.8 bits (68), Expect = 5.9
Identities = 18/46 (39%), Positives = 24/46 (52%)
Frame = +1

Query: 337 TEEGATGVSP*RSPPSAHYASLTSNINFTNSTLP*HSPYVPRQHGL 474
TE GAT VSP S H++ S++ + STLP PY G+
Sbjct: 2449 TEAGATDVSPTASAMFLHHSEYKSSL-YPTSTLPSTEPYKSPSEGI 2493


>sp|O73630|NFKB2_XENLA Nuclear factor NF-kappa-B p100 subunit
OS=Xenopus laevis GN=nfkb2 PE=2 SV=1
Length = 958

Score = 30.4 bits (67), Expect = 7.7
Identities = 22/69 (31%), Positives = 29/69 (42%), Gaps = 8/69 (11%)
Frame = +1

Query: 406 SNINFT----NSTLP*HSP----YVPRQHGLAHCRVTNGGAPVNPMSLQSKKLFDEILTC 561
SNIN+ NS SP Y H + HC TN S+ KK +E C
Sbjct: 378 SNINYQYTGMNSAFYMSSPAGGGYHSSGHMMKHCSATNSSEKNQQPSISIKKEGEEASAC 437

Query: 562 PQSNKLTTS 588
Q++ TT+
Sbjct: 438 SQTDSATTA 446


tr_hit_id A1CQA7
Definition tr|A1CQA7|A1CQA7_ASPCL C2H2 transcription factor, putative OS=Aspergillus clavatus
Align length 69
Score (bit) 36.6
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914311|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_E04.
(618 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A1CQA7|A1CQA7_ASPCL C2H2 transcription factor, putative OS=As... 37 1.2
tr|Q9LX06|Q9LX06_ORYSJ Os06g0107600 protein OS=Oryza sativa subs... 34 6.0
tr|B8B1J0|B8B1J0_ORYSI Putative uncharacterized protein OS=Oryza... 34 6.0
tr|A3B7L8|A3B7L8_ORYSJ Putative uncharacterized protein OS=Oryza... 34 6.0
tr|A2Z4T4|A2Z4T4_ORYSI Putative uncharacterized protein OS=Oryza... 34 6.1
tr|Q47VG6|Q47VG6_COLP3 Rod shape-determining protein MreD OS=Col... 34 7.8
tr|A6DMP1|A6DMP1_9BACT Putative uncharacterized protein OS=Lenti... 34 7.8
tr|A0CJ20|A0CJ20_PARTE Chromosome undetermined scaffold_19, whol... 34 7.9

>tr|A1CQA7|A1CQA7_ASPCL C2H2 transcription factor, putative
OS=Aspergillus clavatus GN=ACLA_025450 PE=4 SV=1
Length = 566

Score = 36.6 bits (83), Expect = 1.2
Identities = 24/69 (34%), Positives = 33/69 (47%), Gaps = 10/69 (14%)
Frame = +1

Query: 28 HLWVPITGPCKPHNQ----PHQHTKIRPMNRLSG*AKHQYTS------RKRGQRLPPYEQ 177
H+ VPI GPC+ H++ PH H I P S ++H +S G+ PP E
Sbjct: 280 HVDVPIKGPCRSHHRCRIHPHSH-HIHPYGPYSPYSRHSRSSVSSQLISSPGETPPPLEG 338

Query: 178 ALPSPLLSP 204
+ S L SP
Sbjct: 339 GISSVLTSP 347


>tr|Q9LX06|Q9LX06_ORYSJ Os06g0107600 protein OS=Oryza sativa subsp.
japonica GN=P0514G12.7-1 PE=4 SV=1
Length = 363

Score = 34.3 bits (77), Expect = 6.0
Identities = 14/34 (41%), Positives = 21/34 (61%)
Frame = -3

Query: 166 VATFGLFSLRYIGVWLTQIAYSLV*FLYVGVVGC 65
VA GL + R + VW+ + + ++ LY GVVGC
Sbjct: 230 VAVVGLSTQRNVSVWIVRTKFHILTILYAGVVGC 263


>tr|B8B1J0|B8B1J0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21319 PE=4 SV=1
Length = 363

Score = 34.3 bits (77), Expect = 6.0
Identities = 14/34 (41%), Positives = 21/34 (61%)
Frame = -3

Query: 166 VATFGLFSLRYIGVWLTQIAYSLV*FLYVGVVGC 65
VA GL + R + VW+ + + ++ LY GVVGC
Sbjct: 230 VAVVGLSTQRNVSVWIVRTKFHILTILYAGVVGC 263


>tr|A3B7L8|A3B7L8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019040 PE=4 SV=1
Length = 376

Score = 34.3 bits (77), Expect = 6.0
Identities = 14/34 (41%), Positives = 21/34 (61%)
Frame = -3

Query: 166 VATFGLFSLRYIGVWLTQIAYSLV*FLYVGVVGC 65
VA GL + R + VW+ + + ++ LY GVVGC
Sbjct: 230 VAVVGLSTQRNVSVWIVRTKFHILTILYAGVVGC 263


>tr|A2Z4T4|A2Z4T4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_32660 PE=4 SV=1
Length = 483

Score = 34.3 bits (77), Expect = 6.1
Identities = 20/63 (31%), Positives = 32/63 (50%)
Frame = +1

Query: 208 YKYPHVVKHSK*HQTIVDALFRI*RGNLH*LKNERVWQRETV*TEEGATGVSP*RSPPSA 387
Y Y H + + ++D ++R+ RG+ L N VW+RE + V+P SP +
Sbjct: 180 YHYCHTITDAFGMAQLLDTIYRLTRGDGDPLTNPPVWERECL-------VVAPSASPRTT 232

Query: 388 HYA 396
HYA
Sbjct: 233 HYA 235


>tr|Q47VG6|Q47VG6_COLP3 Rod shape-determining protein MreD
OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
GN=mreD PE=4 SV=1
Length = 159

Score = 33.9 bits (76), Expect = 7.8
Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
Frame = -2

Query: 155 WPLFLEVYWCLAHPDSLFIGLIFVCW-CGWLCG-LHGPVMGTQRCFFSLS 12
W L + VYWCLA P+ + IF W G++ L G V+G C +LS
Sbjct: 35 WVLIVLVYWCLALPNKI---NIFTAWVMGFILDVLLGSVLGVHACAMALS 81


>tr|A6DMP1|A6DMP1_9BACT Putative uncharacterized protein
OS=Lentisphaera araneosa HTCC2155 GN=LNTAR_16217 PE=4
SV=1
Length = 730

Score = 33.9 bits (76), Expect = 7.8
Identities = 21/66 (31%), Positives = 31/66 (46%)
Frame = -3

Query: 253 WFGVILNALLHGDICRRETRVVMVEPAHMVATFGLFSLRYIGVWLTQIAYSLV*FLYVGV 74
WF ++L AL G + E + H+V F L + VW+ +S V L+VG
Sbjct: 97 WFALLL-ALFPGGVSTTEKAFLNQYVTHVVMVFSLS----LSVWIVVNQHSKVRILFVGA 151

Query: 73 VGCVAC 56
+ C AC
Sbjct: 152 IFCGAC 157


>tr|A0CJ20|A0CJ20_PARTE Chromosome undetermined scaffold_19, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00007922001 PE=4 SV=1
Length = 414

Score = 33.9 bits (76), Expect = 7.9
Identities = 15/46 (32%), Positives = 24/46 (52%)
Frame = +1

Query: 58 KPHNQPHQHTKIRPMNRLSG*AKHQYTSRKRGQRLPPYEQALPSPL 195
+PH QP+ H + N+ +G H ++ Q LPP Q +P P+
Sbjct: 336 QPHIQPNPHPFQQKPNQFAGVQNHFQPNQAPNQNLPPPPQQIPDPI 381