BP914313
Clone id YMU001_000057_E06
Library
Length 615
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_E06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ACAGCATTATGGCATTCTTCCAACGCTCGAGCATTACAACTGTCTGGTAGAACTGTTTGG
TGCCACGGGATACCTTTTAGAAGCAAAACACATGCTTCTAAGCATACCTTTTGAGCATAA
TATCATAGGATGGACTAGTTTGCTGAGTAACTGCAGGCAACATAAGGATATTCCTATCGC
AAGAAAATGCCTGGAAAGAGCTTTGGCAATAGATGCCAAGCATGCTGCGCTCTATGTCAT
TATGGCAGATATTTACAGAGATGCTGGGATGATGGAAGATGCAGAACAGATGGTGTCAAT
GAAAAGGCTGGTTGATTTACAGCACAAACCAACAATGCATCTCTAGATGTCATAATGTTG
TTACGGTTTGCCTTTTTTGTTCCACAGTTTTTTTCATACTTGTATGTTTCACCATGCAAA
TGTTTGTTTCTACAATTTTTTGCCCCTTTTTGTCTTCGAAAGTCCACATTATTTAATGGC
GTGTTGTAACTTAAGGGTCAGGCCACGCTCCTGCTGAGTTATATGAGAGACTATTTCTCT
GTCAGGTCAGTTGTAACTAATGGGTTCCAGACATTTGTACATGCACATCTTGGCTGTAGC
CAATGCTTGGTCGTA
■■Homology search results ■■ -
sp_hit_id Q9SHZ8
Definition sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein At2g22070 OS=Arabidopsis thaliana
Align length 93
Score (bit) 82.4
E-value 2.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914313|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_E06.
(615 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protei... 82 2e-15
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 82 3e-15
sp|Q9LRV9|PP228_ARATH Pentatricopeptide repeat-containing protei... 82 3e-15
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 81 5e-15
sp|Q3E9N1|PP359_ARATH Pentatricopeptide repeat-containing protei... 80 1e-14
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 80 1e-14
sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protei... 78 4e-14
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 77 9e-14
sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protei... 76 1e-13
sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protei... 76 2e-13
sp|P0C8Q8|PP394_ARATH Pentatricopeptide repeat-containing protei... 76 2e-13
sp|Q9FMA1|PP433_ARATH Pentatricopeptide repeat-containing protei... 75 2e-13
sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protei... 75 3e-13
sp|O49619|PP350_ARATH Pentatricopeptide repeat-containing protei... 74 5e-13
sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protei... 74 5e-13
sp|Q8S9M4|PP198_ARATH Pentatricopeptide repeat-containing protei... 74 5e-13
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 74 6e-13
sp|Q9SV26|PP297_ARATH Pentatricopeptide repeat-containing protei... 74 6e-13
sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 73 1e-12
sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protei... 72 2e-12
sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protei... 72 2e-12
sp|Q9STE1|PP333_ARATH Pentatricopeptide repeat-containing protei... 72 2e-12
sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containi... 72 2e-12
sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protei... 72 2e-12
sp|Q9LYU9|PP378_ARATH Pentatricopeptide repeat-containing protei... 72 3e-12
sp|Q9SVH0|PP329_ARATH Pentatricopeptide repeat-containing protei... 72 3e-12
sp|Q9M2Y7|PP274_ARATH Pentatricopeptide repeat-containing protei... 72 3e-12
sp|Q9FND6|PP411_ARATH Pentatricopeptide repeat-containing protei... 71 4e-12
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 71 4e-12
sp|Q9SR82|PP219_ARATH Putative pentatricopeptide repeat-containi... 71 4e-12

>sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein
At2g22070 OS=Arabidopsis thaliana GN=PCMP-H41 PE=2 SV=1
Length = 786

Score = 82.4 bits (202), Expect = 2e-15
Identities = 36/93 (38%), Positives = 59/93 (63%)
Frame = +2

Query: 14 ILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARKCL 193
I+PTL HY C+V+LFG G L EA+ + +P E +++ W SLLS CR HK+I + +
Sbjct: 547 IIPTLSHYACMVDLFGRAGLLQEAQEFIEKMPIEPDVVTWGSLLSACRVHKNIDLGKVAA 606

Query: 194 ERALAIDAKHAALYVIMADIYRDAGMMEDAEQM 292
ER L ++ +++ Y +A++Y G E+A ++
Sbjct: 607 ERLLLLEPENSGAYSALANLYSACGKWEEAAKI 639



Score = 30.4 bits (67), Expect = 7.5
Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 2/95 (2%)
Frame = +2

Query: 38 NCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARKCLERAL--AI 211
N L+ ++ G + A I E + + WTS++ QH A + E L +
Sbjct: 452 NALITMYAKAGNITSASRAFDLIRCERDTVSWTSMIIALAQHGHAEEALELFETMLMEGL 511

Query: 212 DAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVD 316
H YV + AG++ Q M + VD
Sbjct: 512 RPDHIT-YVGVFSACTHAGLVNQGRQYFDMMKDVD 545


>sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containing
protein At3g15130 OS=Arabidopsis thaliana GN=PCMP-H86
PE=3 SV=1
Length = 689

Score = 81.6 bits (200), Expect = 3e-15
Identities = 39/87 (44%), Positives = 59/87 (67%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
+GI P +EHY C+V+L G G L EAKH++ ++P + N+ W +LLS CR H DI + ++
Sbjct: 444 HGIKPRVEHYACVVDLLGRAGRLKEAKHLIDTMPIKPNVGIWQTLLSLCRVHGDIELGKE 503

Query: 188 CLERALAIDAKHAALYVIMADIYRDAG 268
+ L IDAK+ A YV+M+++Y AG
Sbjct: 504 VGKILLRIDAKNPANYVMMSNLYGQAG 530


>sp|Q9LRV9|PP228_ARATH Pentatricopeptide repeat-containing protein
At3g13880 OS=Arabidopsis thaliana GN=PCMP-E89 PE=2 SV=1
Length = 748

Score = 81.6 bits (200), Expect = 3e-15
Identities = 37/110 (33%), Positives = 70/110 (63%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
Y I P +H+ CLV+L G TG L +A++++LS F+ + + W +LLS+CR +KD I ++
Sbjct: 590 YRINPNEKHFTCLVDLLGRTGRLSDAENLILSSGFQDHPVTWRALLSSCRVYKDSVIGKR 649

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKPTM 337
ER + ++ + + YV++ +IY D+G+ AE++ + R ++ +P +
Sbjct: 650 VAERLMELEPEASGSYVLLHNIYNDSGVNSSAEEVRELMRDRGVKKEPAL 699


>sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protein
At1g06140, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E61 PE=2 SV=1
Length = 558

Score = 80.9 bits (198), Expect = 5e-15
Identities = 35/90 (38%), Positives = 61/90 (67%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
YG++P EHY C+V+L G G + EAK + ++P + W +LLS CR HK++ +A +
Sbjct: 443 YGVVPEEEHYACMVDLLGRAGEIGEAKSFIDNMPVKPMASAWGALLSACRIHKEVDLAGE 502

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMME 277
E+ L+++ + +++YV++++IY DAGM E
Sbjct: 503 IAEKLLSMEPEKSSVYVLLSNIYADAGMWE 532


>sp|Q3E9N1|PP359_ARATH Pentatricopeptide repeat-containing protein
At4g39952, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E98 PE=2 SV=2
Length = 775

Score = 79.7 bits (195), Expect = 1e-14
Identities = 37/100 (37%), Positives = 63/100 (63%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
Y + P L+HY+CLV+L +G L EA+ ++S+PF + + W +LLS+C H + + +
Sbjct: 663 YDVKPNLKHYSCLVDLLSRSGNLEEAESTVMSMPFSPDGVIWGTLLSSCMTHGEFEMGIR 722

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKR 307
ERA+A D ++ Y+++A++Y AG E+AE+ M R
Sbjct: 723 MAERAVASDPQNDGYYIMLANMYSAAGKWEEAERAREMMR 762


>sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containing
protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22
PE=3 SV=1
Length = 743

Score = 79.7 bits (195), Expect = 1e-14
Identities = 36/108 (33%), Positives = 62/108 (57%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
YGI+P++ HY+C+++LF +G L EA + +PF + IGWT+LLS CR ++ I +
Sbjct: 502 YGIVPSIGHYSCMIDLFSRSGRLEEAMRFINGMPFPPDAIGWTTLLSACRNKGNLEIGKW 561

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
E + +D H A Y +++ IY G + Q+ R +++ +P
Sbjct: 562 AAESLIELDPHHPAGYTLLSSIYASKGKWDSVAQLRRGMREKNVKKEP 609


>sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protein
At3g26782, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H34 PE=2 SV=1
Length = 659

Score = 77.8 bits (190), Expect = 4e-14
Identities = 33/95 (34%), Positives = 60/95 (63%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
+G+ P LEHY C+V+L G G+L +A ++ + + + I W+SLL+ CR HK++ +A
Sbjct: 418 FGVEPGLEHYGCMVDLLGRAGFLQKAYDLIQRMKMKPDSIIWSSLLAACRIHKNVELAEI 477

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQM 292
+ R +D+ + Y++++ IY DAG +D E++
Sbjct: 478 SVARLFELDSSNCGYYMLLSHIYADAGRWKDVERV 512


>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein
At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=2 SV=1
Length = 697

Score = 76.6 bits (187), Expect = 9e-14
Identities = 32/108 (29%), Positives = 63/108 (58%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
+G+ P +HY C+V+L G G+L EAK M+ +P + + + W SLL+ C+ H++I + +
Sbjct: 523 FGVAPLRDHYTCMVDLLGRAGFLEEAKSMIEEMPMQPDSVIWGSLLAACKVHRNITLGKY 582

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
E+ L ++ ++ YV+++++Y + G ED + R + +P
Sbjct: 583 VAEKLLEVEPSNSGPYVLLSNMYAELGKWEDVMNVRKSMRKEGVTKQP 630


>sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protein
At5g39350 OS=Arabidopsis thaliana GN=PCMP-E16 PE=2 SV=1
Length = 677

Score = 76.3 bits (186), Expect = 1e-13
Identities = 36/110 (32%), Positives = 61/110 (55%)
Frame = +2

Query: 2 QHYGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIA 181
+HY L HY C+V+L G G L EA +++ +IPFE W +LL+ C H+++ +
Sbjct: 553 EHYKTLARSNHYTCIVDLLGRAGRLDEAYNLITTIPFEPTSTVWGALLAACVTHENVQLG 612

Query: 182 RKCLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
+ ++ ++ YV++A+IY G +D E++ SM V L+ KP
Sbjct: 613 EMAANKLFELEPENTGNYVLLANIYAALGRWKDMEKVRSMMENVGLRKKP 662


>sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protein
At1g20230 OS=Arabidopsis thaliana GN=PCMP-H21 PE=2 SV=2
Length = 760

Score = 75.9 bits (185), Expect = 2e-13
Identities = 34/110 (30%), Positives = 62/110 (56%)
Frame = +2

Query: 2 QHYGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIA 181
+ YGI P LEHY+C+V L G G L EA ++ +PFE + W +LL++CR ++ +A
Sbjct: 517 EEYGIKPRLEHYSCMVNLLGRAGKLQEAYDLIKEMPFEPDSCVWGALLNSCRLQNNVDLA 576

Query: 182 RKCLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
E+ ++ ++ YV++++IY GM + + + + + L+ P
Sbjct: 577 EIAAEKLFHLEPENPGTYVLLSNIYAAKGMWTEVDSIRNKMESLGLKKNP 626


tr_hit_id A9T8E9
Definition tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 97
Score (bit) 86.3
E-value 1.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914313|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_E06.
(615 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 86 1e-15
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 86 2e-15
tr|A7QJF8|A7QJF8_VITVI Chromosome chr8 scaffold_106, whole genom... 85 4e-15
tr|A7Q9C2|A7Q9C2_VITVI Chromosome chr19 scaffold_66, whole genom... 85 4e-15
tr|A5APN9|A5APN9_VITVI Putative uncharacterized protein OS=Vitis... 85 4e-15
tr|A5B3U0|A5B3U0_VITVI Putative uncharacterized protein OS=Vitis... 84 5e-15
tr|A7PAH3|A7PAH3_VITVI Chromosome chr14 scaffold_9, whole genome... 84 9e-15
tr|A7R678|A7R678_VITVI Chromosome undetermined scaffold_1179, wh... 83 1e-14
tr|A5BL66|A5BL66_VITVI Putative uncharacterized protein OS=Vitis... 83 1e-14
tr|B4FXR7|B4FXR7_MAIZE Putative uncharacterized protein OS=Zea m... 80 7e-14
tr|A7PS78|A7PS78_VITVI Chromosome chr14 scaffold_27, whole genom... 80 7e-14
tr|Q8LQE8|Q8LQE8_ORYSJ Pentatricopeptide (PPR) repeat-containing... 80 9e-14
tr|Q0D4B1|Q0D4B1_ORYSJ Os07g0636900 protein (Fragment) OS=Oryza ... 80 9e-14
tr|A7PCR5|A7PCR5_VITVI Chromosome chr17 scaffold_12, whole genom... 80 9e-14
tr|A3BML6|A3BML6_ORYSJ Putative uncharacterized protein OS=Oryza... 80 9e-14
tr|A3B7R9|A3B7R9_ORYSJ Putative uncharacterized protein OS=Oryza... 80 9e-14
tr|A2WWE8|A2WWE8_ORYSI Putative uncharacterized protein OS=Oryza... 80 9e-14
tr|Q2QN60|Q2QN60_ORYSJ Pentatricopeptide, putative, expressed OS... 80 1e-13
tr|Q0IMC8|Q0IMC8_ORYSJ Os12g0578000 protein OS=Oryza sativa subs... 80 1e-13
tr|A9P0W0|A9P0W0_PICSI Putative uncharacterized protein OS=Picea... 80 1e-13
tr|A7Q0E2|A7Q0E2_VITVI Chromosome chr7 scaffold_42, whole genome... 80 1e-13
tr|A7P9K4|A7P9K4_VITVI Chromosome chr3 scaffold_8, whole genome ... 80 1e-13
tr|A3CIS7|A3CIS7_ORYSJ Putative uncharacterized protein OS=Oryza... 80 1e-13
tr|A2ZM04|A2ZM04_ORYSI Putative uncharacterized protein OS=Oryza... 80 1e-13
tr|Q654C7|Q654C7_ORYSJ Os06g0506100 protein OS=Oryza sativa subs... 79 2e-13
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 79 2e-13
tr|A7QQL3|A7QQL3_VITVI Chromosome undetermined scaffold_143, who... 79 2e-13
tr|A7PL36|A7PL36_VITVI Chromosome chr7 scaffold_20, whole genome... 79 2e-13
tr|A5AX00|A5AX00_VITVI Putative uncharacterized protein OS=Vitis... 79 2e-13
tr|A5ASX4|A5ASX4_VITVI Putative uncharacterized protein OS=Vitis... 79 2e-13

>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 86.3 bits (212), Expect = 1e-15
Identities = 37/97 (38%), Positives = 63/97 (64%)
Frame = +2

Query: 2 QHYGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIA 181
Q + I+PT+EHY C+V+L G G L EA+ ++ ++PF+ N W +LL CR H ++P+A
Sbjct: 659 QDFAIIPTIEHYGCMVDLLGRAGQLDEAEALIKTMPFQANTRIWGALLGACRIHGNVPVA 718

Query: 182 RKCLERALAIDAKHAALYVIMADIYRDAGMMEDAEQM 292
+ E +L +D +A +YV ++ +Y AGM + A ++
Sbjct: 719 ERAAESSLKLDLDNAVVYVALSHMYAAAGMWDSAAKL 755


>tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175641 PE=4 SV=1
Length = 723

Score = 85.5 bits (210), Expect = 2e-15
Identities = 42/108 (38%), Positives = 62/108 (57%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
YGI P +EHY+C V+L G G+L EA++++LS+PF W +LLS CR H D+ +
Sbjct: 482 YGIKPMVEHYSCFVDLLGRAGHLEEAENVILSMPFIPGPSVWGALLSACRVHSDVERGER 541

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
E L +D YV ++ IY AG EDAE++ + D+ +P
Sbjct: 542 AAENVLKLDPDDDGAYVALSSIYAAAGRYEDAEKVRQVMEKRDVVKEP 589


>tr|A7QJF8|A7QJF8_VITVI Chromosome chr8 scaffold_106, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000621001
PE=4 SV=1
Length = 523

Score = 84.7 bits (208), Expect = 4e-15
Identities = 39/95 (41%), Positives = 60/95 (63%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
YGI P +EHY C+V+L G G L EA ++ +PFE N + W +LLS CR H ++ I
Sbjct: 282 YGIKPQMEHYGCMVDLLGRYGCLEEAYDLVQKMPFEANSVIWRALLSACRTHGNVKIGEI 341

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQM 292
++ L ++A+H A YV++++I DA E+A Q+
Sbjct: 342 AGQKLLEMEAQHGARYVLLSNILADANQWEEARQV 376


>tr|A7Q9C2|A7Q9C2_VITVI Chromosome chr19 scaffold_66, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033416001
PE=4 SV=1
Length = 632

Score = 84.7 bits (208), Expect = 4e-15
Identities = 40/109 (36%), Positives = 66/109 (60%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
YGI+P +EHY C+V+L G L EA +L++P + N + W +LL CR HK++ +A +
Sbjct: 391 YGIIPQIEHYGCMVDLLSRAGLLHEAHEFILNMPMKPNGVVWGALLGACRVHKNVEMAEE 450

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKPT 334
++ L +D + YV++++IY +AG ED ++ K + D Q K T
Sbjct: 451 AIKHLLELDPLNDGYYVVLSNIYAEAGRWEDTARV--RKFMKDRQVKKT 497


>tr|A5APN9|A5APN9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_040250 PE=4 SV=1
Length = 606

Score = 84.7 bits (208), Expect = 4e-15
Identities = 40/109 (36%), Positives = 66/109 (60%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
YGI+P +EHY C+V+L G L EA +L++P + N + W +LL CR HK++ +A +
Sbjct: 391 YGIIPQIEHYGCMVDLLSRAGLLHEAHEFILNMPMKPNGVVWGALLGACRVHKNVEMAEE 450

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKPT 334
++ L +D + YV++++IY +AG ED ++ K + D Q K T
Sbjct: 451 AIKHLLELDPLNDGYYVVLSNIYAEAGRWEDTARV--RKFMKDRQVKKT 497


>tr|A5B3U0|A5B3U0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_035978 PE=4 SV=1
Length = 814

Score = 84.3 bits (207), Expect = 5e-15
Identities = 36/109 (33%), Positives = 69/109 (63%)
Frame = +2

Query: 5 HYGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIAR 184
+YG+ P LEHY+C+V++ G +G + +A ++ +PFE + + W +LLS C+ H ++ +A
Sbjct: 645 NYGLDPQLEHYSCVVDIMGRSGQVSKALELIEGMPFEADAVIWRTLLSXCKIHGNVEVAE 704

Query: 185 KCLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
K L ++ + +A YV++++IY +AGM + ++ M R L+ +P
Sbjct: 705 KAAYSILQLEPEDSAAYVLLSNIYANAGMWNEVTKLRKMMRFNGLKKEP 753


>tr|A7PAH3|A7PAH3_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038113001
PE=4 SV=1
Length = 778

Score = 83.6 bits (205), Expect = 9e-15
Identities = 36/109 (33%), Positives = 69/109 (63%)
Frame = +2

Query: 5 HYGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIAR 184
+YG+ P LEHY+C+V++ G +G + +A ++ +PFE + + W +LLS C+ H ++ +A
Sbjct: 609 NYGLDPQLEHYSCVVDIMGRSGQVSKALELIEGMPFEADAVIWRTLLSICKIHGNVEVAE 668

Query: 185 KCLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
K L ++ + +A YV++++IY +AGM + ++ M R L+ +P
Sbjct: 669 KAAYSILQLEPEDSAAYVLLSNIYANAGMWNEVTKLRKMMRFNGLKKEP 717


>tr|A7R678|A7R678_VITVI Chromosome undetermined scaffold_1179, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00008013001 PE=4 SV=1
Length = 704

Score = 83.2 bits (204), Expect = 1e-14
Identities = 38/110 (34%), Positives = 64/110 (58%)
Frame = +2

Query: 2 QHYGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIA 181
+ + I P EHY+C+++L G G L EA++++ +PF IGW SLL CR H +I +A
Sbjct: 473 EKFNIEPEAEHYSCMIDLLGRAGKLSEAENLIARMPFNPGSIGWASLLGACRTHGNIELA 532

Query: 182 RKCLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
K + L ++ +AA YV+++++Y AG E+ + R ++ KP
Sbjct: 533 VKAANQVLQLEPSNAAPYVVLSNMYASAGRWEEVATVRKFMRDRGVKKKP 582


>tr|A5BL66|A5BL66_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037837 PE=4 SV=1
Length = 719

Score = 83.2 bits (204), Expect = 1e-14
Identities = 38/110 (34%), Positives = 64/110 (58%)
Frame = +2

Query: 2 QHYGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIA 181
+ + I P EHY+C+++L G G L EA++++ +PF IGW SLL CR H +I +A
Sbjct: 473 EKFNIEPEAEHYSCMIDLLGRAGKLSEAENLIARMPFNPGSIGWASLLGACRTHGNIELA 532

Query: 182 RKCLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
K + L ++ +AA YV+++++Y AG E+ + R ++ KP
Sbjct: 533 VKAANQVLQLEPSNAAPYVVLSNMYASAGRWEEVATVRKFMRDRGVKKKP 582


>tr|B4FXR7|B4FXR7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 375

Score = 80.5 bits (197), Expect = 7e-14
Identities = 38/108 (35%), Positives = 61/108 (56%)
Frame = +2

Query: 8 YGILPTLEHYNCLVELFGATGYLLEAKHMLLSIPFEHNIIGWTSLLSNCRQHKDIPIARK 187
YGI+PT EH +C+++L G L EA + +PFE +II W +LL+ R H D+ + ++
Sbjct: 190 YGIVPTKEHCSCVIDLLARAGRLSEAAKFVDQMPFEPDIIMWNTLLAASRTHNDVEMGKR 249

Query: 188 CLERALAIDAKHAALYVIMADIYRDAGMMEDAEQMVSMKRLVDLQHKP 331
E L ID H+A YV++ +IY +G + ++ R +Q P
Sbjct: 250 AAEGVLNIDPSHSAAYVLLCNIYASSGNWNEFARLKKDMRSSGVQKSP 297