BP914316
Clone id YMU001_000057_E09
Library
Length 518
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_E09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGGCTTGAACGAGGTTGTCCACATATACCCAATCTGTCTTGACCTCAGGACCACCAATAA
CACACAATAACATCCCTTTCTGAGCCAAGTCCAAAAGCCGTGGTAAGTGGTGCTCCTCAT
GTGGTCCATACACAGGGGCGGGCCTTATTGCACAAGTATGCAGCTTACCGCCAGACTTTG
ACTTTAGAGGCCGACCATTACTTTTCAACACTATCTGCTCAGCCAGAGCTTTACACCGAC
CATAGGAATCCAGATGTGTATCGATCGGGAAATAACCCATGTTTTCATTGCCGTCCACAA
TTTCTTGTCCCCCGAAGACCACATTGTAGCTACTAGCAAAAACAAGCCTCTCAACTCCAT
ATTTCACACAGCTATCCAGTATATTGCAAGTCCCTGTGAGGTTGACTTCGTCGATTTTGC
GAGCACGAAGCATCTCCTTTCCAGATATGCCATATGAAGCAAGATGAAACACACAATTTG
CTCCACAAAGAGCCTTATCTGTCTCCTCCTTCCGCTTG
■■Homology search results ■■ -
sp_hit_id A8DZE7
Definition sp|A8DZE7|YP022_DANRE 3-beta-HSD family protein HSPC105 homolog OS=Danio rerio
Align length 168
Score (bit) 175.0
E-value 1.0e-43
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914316|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_E09.
(518 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A8DZE7|YP022_DANRE 3-beta-HSD family protein HSPC105 homolog ... 175 1e-43
sp|Q32L94|YP022_BOVIN 3-beta-HSD family protein HSPC105 homolog ... 169 9e-42
sp|Q4R7R1|YP022_MACFA 3-beta-HSD family protein HSPC105 homolog ... 167 2e-41
sp|Q0IH73|YP022_XENLA 3-beta-HSD family protein HSPC105 homolog ... 166 8e-41
sp|Q8WUS8|YP022_HUMAN 3-beta-HSD family protein HSPC105 OS=Homo ... 165 1e-40
sp|Q9D665|YP022_MOUSE 3-beta-HSD family protein HSPC105 homolog ... 160 3e-39
sp|A6NKP2|YP030_HUMAN Putative 3-beta-HSD family protein ENSP000... 157 2e-38
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase... 86 8e-17
sp|Q5PPL3|NSDHL_RAT Sterol-4-alpha-carboxylate 3-dehydrogenase, ... 86 1e-16
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase... 85 2e-16
sp|Q15738|NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase... 84 3e-16
sp|O43050|ERG26_SCHPO Sterol-4-alpha-carboxylate 3-dehydrogenase... 82 2e-15
sp|Q67477|3BHS_FOWPV 3 beta-hydroxysteroid dehydrogenase/Delta 5... 82 2e-15
sp|Q3ZBE9|NSDHL_BOVIN Sterol-4-alpha-carboxylate 3-dehydrogenase... 80 4e-15
sp|Q9EQC1|3BHS7_MOUSE 3 beta-hydroxysteroid dehydrogenase type 7... 79 1e-14
sp|Q9H2F3|3BHS7_HUMAN 3 beta-hydroxysteroid dehydrogenase type 7... 76 8e-14
sp|P24815|3BHS1_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta ... 74 4e-13
sp|O35469|3BHS6_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta ... 71 3e-12
sp|P22071|3BHS1_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-... 70 5e-12
sp|P26150|3BHS3_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta ... 68 2e-11
sp|Q60555|3BHS1_MESAU 3 beta-hydroxysteroid dehydrogenase/Delta ... 67 4e-11
sp|Q64421|3BHS2_MESAU 3 beta-hydroxysteroid dehydrogenase/Delta ... 67 5e-11
sp|P22072|3BHS2_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-... 65 2e-10
sp|P26149|3BHS2_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta ... 64 3e-10
sp|Q62878|3BHS4_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-... 63 7e-10
sp|P26670|3BHS_VACCW 3 beta-hydroxysteroid dehydrogenase/Delta 5... 62 1e-09
sp|P21097|3BHS_VACCC 3 beta-hydroxysteroid dehydrogenase/Delta 5... 62 1e-09
sp|O57245|3BHS_VACCA 3 beta-hydroxysteroid dehydrogenase/Delta 5... 62 1e-09
sp|O35048|3BHS7_RAT 3 beta-hydroxysteroid dehydrogenase type 7 O... 62 1e-09
sp|Q5IFP1|3BHS_CANFA 3 beta-hydroxysteroid dehydrogenase/Delta 5... 60 8e-09

>sp|A8DZE7|YP022_DANRE 3-beta-HSD family protein HSPC105 homolog
OS=Danio rerio GN=si:ch211-79l17.4 PE=2 SV=1
Length = 387

Score = 175 bits (443), Expect = 1e-43
Identities = 84/168 (50%), Positives = 120/168 (71%)
Frame = -2

Query: 505 ETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSY 326
+ +KA+ G++CVFH+ASYG+SG+E L + I+EVN+ GT NIL +CV + V RL++ S++
Sbjct: 62 QVEKAVRGSHCVFHIASYGMSGREQLNRKLIEEVNVKGTENILRACVAHSVPRLIYTSTF 121

Query: 325 NVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAI 146
NVVFGGQEI +G+E++ Y P+ H D Y R K++AE VLK+N L S S G L TCA+
Sbjct: 122 NVVFGGQEIKNGDESLPYLPLHLHPDHYSRTKSIAEMQVLKANNLAL-SNSTGVLRTCAL 180

Query: 145 RPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
RPA +YGP E+ HLPR++ + G+ V G P+ ++V+VDNLV A
Sbjct: 181 RPAGIYGPGEQRHLPRIVSYIENGIFRFVYGDPDSLVEFVHVDNLVSA 228


>sp|Q32L94|YP022_BOVIN 3-beta-HSD family protein HSPC105 homolog
OS=Bos taurus PE=2 SV=2
Length = 393

Score = 169 bits (427), Expect = 9e-42
Identities = 80/158 (50%), Positives = 114/158 (72%)
Frame = -2

Query: 475 CVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSYNVVFGGQEIV 296
CVFH+ASYG+SG+E L I+E+N+ GT NIL +C + GV RLV+ S++NV+FGGQ I
Sbjct: 75 CVFHIASYGMSGREQLNRSLIEEINVGGTDNILQACRRRGVPRLVYTSTFNVIFGGQVIR 134

Query: 295 DGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAIRPAPVYGPHE 116
+G+E++ Y P+ H D Y R K++AE+ VL +NG L+ + GG L TCA+RPA +YGP E
Sbjct: 135 NGDESLPYLPLHLHPDHYSRTKSIAEKKVLSANGTALE-RGGGVLSTCALRPAGIYGPGE 193

Query: 115 EHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
+ HLPR++ +KG+ V G P+ ++V+VDNLVQA
Sbjct: 194 QRHLPRIVSYIEKGLFRFVYGDPKSLVEFVHVDNLVQA 231


>sp|Q4R7R1|YP022_MACFA 3-beta-HSD family protein HSPC105 homolog
OS=Macaca fascicularis GN=QtsA-14586 PE=2 SV=1
Length = 393

Score = 167 bits (424), Expect = 2e-41
Identities = 80/158 (50%), Positives = 112/158 (70%)
Frame = -2

Query: 475 CVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSYNVVFGGQEIV 296
CVFH+ASYG+SG+E L I+EVN+ GT NIL +C + V RLV+ S++NV+FGGQ I
Sbjct: 75 CVFHIASYGMSGREQLNRNLIEEVNIGGTDNILQACQRRRVPRLVYTSTFNVIFGGQVIR 134

Query: 295 DGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAIRPAPVYGPHE 116
+G+E++ Y P+ H D Y R K++AE+ VL++NG PL + G L TCA+RPA +YGP E
Sbjct: 135 NGDESLPYLPLHLHPDHYSRTKSIAEKKVLEANGTPL-DRGDGVLRTCALRPAGIYGPGE 193

Query: 115 EHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
+ HLPR++ +KG+ V G P ++V+VDNLVQA
Sbjct: 194 QRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQA 231


>sp|Q0IH73|YP022_XENLA 3-beta-HSD family protein HSPC105 homolog
OS=Xenopus laevis PE=2 SV=1
Length = 386

Score = 166 bits (419), Expect = 8e-41
Identities = 80/168 (47%), Positives = 115/168 (68%)
Frame = -2

Query: 505 ETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSY 326
+ + + GA+CVFH ASYG+SGKE L +KI+ +N+ GT NI+ +C+ V RLV+ S++
Sbjct: 63 QLEDVVAGASCVFHTASYGMSGKEQLHRQKIEAINVRGTENIIQACINTNVPRLVYTSTF 122

Query: 325 NVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAI 146
NV+FGGQ I DG+E++ Y P D +D+Y R K +AE VLK N + LK+ S G L TC++
Sbjct: 123 NVIFGGQTIRDGDESLPYLPQDAFVDNYSRTKTVAEMFVLKMNNQELKNNS-GFLRTCSL 181

Query: 145 RPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
R A +YGP E+ HLPR++ +KGM L V G + +V+VDNL+ A
Sbjct: 182 RAAGIYGPGEQRHLPRIISALEKGMFLFVYGDNPL-VQFVHVDNLISA 228


>sp|Q8WUS8|YP022_HUMAN 3-beta-HSD family protein HSPC105 OS=Homo
sapiens GN=HSPC105 PE=2 SV=2
Length = 393

Score = 165 bits (417), Expect = 1e-40
Identities = 83/170 (48%), Positives = 115/170 (67%), Gaps = 2/170 (1%)
Frame = -2

Query: 505 ETDKALCGAN--CVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFAS 332
+ +KA A+ CVFH+ASYG+SG+E L I EVN+ GT NIL C + V RLV+ S
Sbjct: 63 DVEKAFQDADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTS 122

Query: 331 SYNVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTC 152
++NV+FGGQ I +G+E++ Y P+ H D Y R K++AEQ VL++N PL + G L TC
Sbjct: 123 TFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEQKVLEANATPL-DRGDGVLRTC 181

Query: 151 AIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
A+RPA +YGP E+ HLPR++ +KG+ V G P ++V+VDNLVQA
Sbjct: 182 ALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQA 231


>sp|Q9D665|YP022_MOUSE 3-beta-HSD family protein HSPC105 homolog
OS=Mus musculus PE=2 SV=1
Length = 394

Score = 160 bits (406), Expect = 3e-39
Identities = 77/158 (48%), Positives = 113/158 (71%)
Frame = -2

Query: 475 CVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSYNVVFGGQEIV 296
CVFH+ASYG+SG+E L +I+EVN+ GT NIL +C++ GV RLV+ S++NV+FGGQ I
Sbjct: 76 CVFHVASYGMSGREQLNKTQIEEVNVGGTENILRACLERGVPRLVYTSTFNVIFGGQVIR 135

Query: 295 DGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAIRPAPVYGPHE 116
+G+E++ Y P+ H D Y R K++AE+ VL++NG K + G L TCAIRPA +YG E
Sbjct: 136 NGDESLPYLPLHLHPDHYSRTKSIAEKKVLEANGLAFK-QGDGILRTCAIRPAGIYGAGE 194

Query: 115 EHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
+ HLPR++ ++G+ V G P+ ++V+VDNL +A
Sbjct: 195 QRHLPRIVSYIERGLFRFVYGDPQSLVEFVHVDNLAKA 232


>sp|A6NKP2|YP030_HUMAN Putative 3-beta-HSD family protein
ENSP00000330812 OS=Homo sapiens PE=3 SV=3
Length = 422

Score = 157 bits (398), Expect = 2e-38
Identities = 76/171 (44%), Positives = 113/171 (66%), Gaps = 1/171 (0%)
Frame = -2

Query: 511 KEETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFAS 332
+E +A G +CVFH+ASYG+SG E L+ +I+ +N+ GT ++D CV+ V RL++ S
Sbjct: 86 EEALYRAFEGVDCVFHVASYGMSGAEKLQKEQIESINVGGTKLVIDVCVRRRVPRLIYTS 145

Query: 331 SYNVVFGGQEIVDGNE-NMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHT 155
+ NV FGG+ I G+E ++ YFP+D H+D Y R KA+A+Q+ L +NG PL GG L T
Sbjct: 146 TVNVAFGGKPIEQGDEDSVPYFPLDEHVDHYSRTKAIADQLTLMANGMPL--PGGGTLRT 203

Query: 154 CAIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
C +RP +YGP E+ HLPR+ +K + + G + + +WV+V NLVQA
Sbjct: 204 CVLRPPGIYGPEEQRHLPRVAGHIKKRLFMFRFGDHKARMNWVHVHNLVQA 254


>sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase,
decarboxylating OS=Saccharomyces cerevisiae GN=ERG26
PE=1 SV=1
Length = 349

Score = 86.3 bits (212), Expect = 8e-17
Identities = 50/138 (36%), Positives = 75/138 (54%), Gaps = 1/138 (0%)
Frame = -2

Query: 412 DEVNLTGTCNILDSCVKYGVERLVFASSYNVVFGGQEIVDGNENMGYFPI-DTHLDSYGR 236
D VN+ GT N++D C K GV LV+ SS V+F GQ++ + +E +PI + +D+Y
Sbjct: 97 DIVNVKGTRNVIDMCKKCGVNILVYTSSAGVIFNGQDVHNADET---WPIPEVPMDAYNE 153

Query: 235 CKALAEQIVLKSNGRPLKSKSGGKLHTCAIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVI 56
KA+AE +VLK+N +T A+RPA ++GP + +P L +A+ G I
Sbjct: 154 TKAIAEDMVLKAN------DPSSDFYTVALRPAGIFGPGDRQLVPGLRQVAKLGQSKFQI 207

Query: 55 GGPEVKTDWVYVDNLVQA 2
G DW Y N+ A
Sbjct: 208 GDNNNLFDWTYAGNVADA 225


>sp|Q5PPL3|NSDHL_RAT Sterol-4-alpha-carboxylate 3-dehydrogenase,
decarboxylating OS=Rattus norvegicus GN=Nsdhl PE=2 SV=1
Length = 362

Score = 85.9 bits (211), Expect = 1e-16
Identities = 58/164 (35%), Positives = 91/164 (55%), Gaps = 2/164 (1%)
Frame = -2

Query: 493 ALCGANCVFHLAS--YGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSYNV 320
AL G + VFH AS + KE+ VN TGT ++++C + GV++L+ SS +V
Sbjct: 83 ALKGVSTVFHCASPPSNSNNKELFY-----RVNSTGTKTVIETCKEAGVQKLILTSSASV 137

Query: 319 VFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAIRP 140
VF G +I +G E++ Y +D Y K L E+ VL +N P K+ T AIRP
Sbjct: 138 VFEGVDIKNGTEDLPY--AMKPIDYYTETKILQERAVLDAND-PKKN-----FLTAAIRP 189

Query: 139 APVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLV 8
++GP + +P L+D A+KG + +IG + D+ +V+N+V
Sbjct: 190 HGIFGPRDPQLVPVLIDAARKGKMKFMIGNGKNLVDFTFVENVV 233


>sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase,
decarboxylating OS=Mus musculus GN=Nsdhl PE=2 SV=1
Length = 362

Score = 84.7 bits (208), Expect = 2e-16
Identities = 59/165 (35%), Positives = 91/165 (55%), Gaps = 3/165 (1%)
Frame = -2

Query: 493 ALCGANCVFHLAS---YGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSYN 323
AL G + VFH AS Y + KE+ VN GT ++++C + GV++L+ SS +
Sbjct: 83 ALKGVSTVFHCASPPPYS-NNKELFY-----RVNFIGTKTVIETCREAGVQKLILTSSAS 136

Query: 322 VVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAIR 143
VVF G +I +G E++ Y +D Y K L E+ VL +N P K+ T AIR
Sbjct: 137 VVFEGVDIKNGTEDLPYAM--KPIDYYTETKILQERAVLDAND-PKKN-----FLTAAIR 188

Query: 142 PAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLV 8
P ++GP + +P L+D A+KG + +IG E D+ +V+N+V
Sbjct: 189 PHGIFGPRDPQLVPILIDAARKGKMKFMIGNGENLVDFTFVENVV 233


tr_hit_id A9STX1
Definition tr|A9STX1|A9STX1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 172
Score (bit) 233.0
E-value 6.0e-60
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914316|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_E09.
(518 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9STX1|A9STX1_PHYPA Predicted protein OS=Physcomitrella paten... 233 6e-60
tr|A7QPG5|A7QPG5_VITVI Chromosome chr18 scaffold_137, whole geno... 233 6e-60
tr|Q6ZHP8|Q6ZHP8_ORYSJ Os02g0715200 protein OS=Oryza sativa subs... 231 1e-59
tr|B8AHL9|B8AHL9_ORYSI Putative uncharacterized protein OS=Oryza... 231 1e-59
tr|A3AAP6|A3AAP6_ORYSJ Putative uncharacterized protein OS=Oryza... 231 1e-59
tr|B4FG67|B4FG67_MAIZE Putative uncharacterized protein OS=Zea m... 229 5e-59
tr|O22813|O22813_ARATH Putative steroid dehydrogenase (At2g33630... 220 3e-56
tr|Q4T1H0|Q4T1H0_TETNG Chromosome undetermined SCAF10591, whole ... 177 3e-43
tr|A6MZK1|A6MZK1_ORYSI Putative nad (P)-dependent cholesterol de... 173 4e-42
tr|A5HL68|A5HL68_ORYLA 3-beta-hydroxysteroid dehydrogenase 2 (Fr... 166 5e-40
tr|B3RMG5|B3RMG5_TRIAD Putative uncharacterized protein OS=Trich... 166 6e-40
tr|B6L1C4|B6L1C4_BRAFL Putative uncharacterized protein OS=Branc... 166 8e-40
tr|B2RDS1|B2RDS1_HUMAN cDNA, FLJ96743, Homo sapiens NAD(P) depen... 165 1e-39
tr|A7RJW6|A7RJW6_NEMVE Predicted protein OS=Nematostella vectens... 164 2e-39
tr|B6NCS4|B6NCS4_BRAFL Putative uncharacterized protein OS=Branc... 163 5e-39
tr|A9VB77|A9VB77_MONBE Predicted protein OS=Monosiga brevicollis... 139 8e-32
tr|A8JAD0|A8JAD0_CHLRE Predicted protein (Fragment) OS=Chlamydom... 128 2e-28
tr|Q54TU9|Q54TU9_DICDI 3beta-hydroxysteroid dehydrogenase OS=Dic... 109 7e-23
tr|O64845|O64845_ARATH 3-beta-hydroxysteroid dehydrogenase (4alp... 101 3e-20
tr|Q9FX01|Q9FX01_ARATH T3F24.9 protein (Putative 3-beta-hydroxys... 99 1e-19
tr|Q0VH36|Q0VH36_ARATH 4alpha-carboxysterol-C3-dehydrogenase/C4-... 99 1e-19
tr|Q8LER8|Q8LER8_ARATH 3-beta-hydroxysteroid dehydrogenase, puta... 97 5e-19
tr|A6DIP8|A6DIP8_9BACT Putative uncharacterized protein OS=Lenti... 95 2e-18
tr|A8J1I4|A8J1I4_CHLRE NAD(P)-dependent steroid dehydrogenase (F... 95 2e-18
tr|Q67ZE1|Q67ZE1_ARATH 3-beta-hydroxysteroid dehydrogenase OS=Ar... 94 3e-18
tr|Q56YU7|Q56YU7_ARATH 3-beta-hydroxysteroid dehydrogenase OS=Ar... 94 3e-18
tr|Q7Y0G5|Q7Y0G5_ORYSJ Putative 3-beta hydroxysteroid dehydrogen... 93 9e-18
tr|Q7Y0G4|Q7Y0G4_ORYSJ Os03g0405000 protein OS=Oryza sativa subs... 93 9e-18
tr|Q084U4|Q084U4_SHEFN 3-beta hydroxysteroid dehydrogenase/isome... 92 1e-17
tr|B8AJS3|B8AJS3_ORYSI Putative uncharacterized protein OS=Oryza... 92 1e-17

>tr|A9STX1|A9STX1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_215702 PE=4 SV=1
Length = 487

Score = 233 bits (593), Expect = 6e-60
Identities = 106/172 (61%), Positives = 139/172 (80%)
Frame = -2

Query: 517 KRKEETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVF 338
+RK + +KAL A+CVFH+AS+G+SGKEML++R IDEVN+ GTC+ILDSC K GV RLV+
Sbjct: 68 RRKADVEKALKNADCVFHMASFGMSGKEMLQSRHIDEVNVDGTCHILDSCAKCGVRRLVY 127

Query: 337 ASSYNVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLH 158
S+YNVV+GGQEI +G EN+ YFPI+ H+D YGR KALAEQ V++S+GRPL +K G +L+
Sbjct: 128 TSTYNVVYGGQEIRNGTENLPYFPIEKHVDPYGRSKALAEQFVIRSSGRPLGNKKGKRLY 187

Query: 157 TCAIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
TCA+RPA +YGP E+ H PR++ +A+ G+L IGGP + TDWVY DNLV A
Sbjct: 188 TCALRPAAIYGPGEQRHFPRIIQMARLGLLKFRIGGPNILTDWVYGDNLVHA 239


>tr|A7QPG5|A7QPG5_VITVI Chromosome chr18 scaffold_137, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002931001
PE=4 SV=1
Length = 478

Score = 233 bits (593), Expect = 6e-60
Identities = 102/170 (60%), Positives = 142/170 (83%)
Frame = -2

Query: 511 KEETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFAS 332
K++ ++AL GA+CVFHLASYG+SGKEM++ ++DEVN+ GTC+ILD+C+++G++RLV+ S
Sbjct: 69 KKDVERALRGADCVFHLASYGMSGKEMIQYGRVDEVNINGTCHILDACIEFGIKRLVYTS 128

Query: 331 SYNVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTC 152
+YNVVFGG+EI++GNE + YFP+D H+DSY R K++AEQ+VLK+NGRP K+KSG L+TC
Sbjct: 129 TYNVVFGGKEILNGNEALPYFPLDDHVDSYSRSKSIAEQLVLKNNGRPFKNKSGKCLYTC 188

Query: 151 AIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
A+RPA +YGP E+ H PR++ LA+ G+L IG VK DW+YVDNLV A
Sbjct: 189 AVRPAAIYGPGEDRHFPRIISLAKLGVLPFTIGEANVKGDWIYVDNLVHA 238


>tr|Q6ZHP8|Q6ZHP8_ORYSJ Os02g0715200 protein OS=Oryza sativa subsp.
japonica GN=OJ1191_G08.12 PE=2 SV=1
Length = 478

Score = 231 bits (590), Expect = 1e-59
Identities = 105/172 (61%), Positives = 138/172 (80%)
Frame = -2

Query: 517 KRKEETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVF 338
++KE+ KAL G +CVFHLASYG+SGKEM++A + DEVN+ GTCN+LD+C ++GV RLV+
Sbjct: 67 RKKEDVGKALRGVDCVFHLASYGMSGKEMVQAGRADEVNINGTCNVLDACHEHGVRRLVY 126

Query: 337 ASSYNVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLH 158
S+YNVVFGG+ IV+GNE + YFP++ H+D+Y R K++AEQ+VLKSNGR KS +L+
Sbjct: 127 VSTYNVVFGGEPIVNGNEALPYFPVEDHVDAYARSKSIAEQLVLKSNGRQTKSDKSSRLY 186

Query: 157 TCAIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
TC+IRPA +YGP EE HLPR+L LA+ G+ IG P VK+DWVYVDNLV A
Sbjct: 187 TCSIRPAAIYGPGEERHLPRILSLAKLGLAFFKIGDPNVKSDWVYVDNLVLA 238


>tr|B8AHL9|B8AHL9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08687 PE=4 SV=1
Length = 477

Score = 231 bits (590), Expect = 1e-59
Identities = 106/172 (61%), Positives = 138/172 (80%)
Frame = -2

Query: 517 KRKEETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVF 338
++KE+ KAL G +CVFHLASYG+SGKEM++A + DEVN+ GTCN+LD+C ++GV RLV+
Sbjct: 67 RKKEDVGKALRGVDCVFHLASYGMSGKEMVQAGRADEVNINGTCNVLDACHEHGVRRLVY 126

Query: 337 ASSYNVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLH 158
S+YNVVFGG+ IV+GNE + YFPI+ H+D+Y R K++AEQ+VLKSNGR KS +L+
Sbjct: 127 VSTYNVVFGGEPIVNGNEVLPYFPIEDHVDAYARSKSIAEQLVLKSNGRQTKSDKSSRLY 186

Query: 157 TCAIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
TC+IRPA +YGP EE HLPR+L LA+ G+ IG P VK+DWVYVDNLV A
Sbjct: 187 TCSIRPAAIYGPGEERHLPRILSLAKLGLAFFKIGDPNVKSDWVYVDNLVLA 238


>tr|A3AAP6|A3AAP6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_007868 PE=4 SV=1
Length = 506

Score = 231 bits (590), Expect = 1e-59
Identities = 105/172 (61%), Positives = 138/172 (80%)
Frame = -2

Query: 517 KRKEETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVF 338
++KE+ KAL G +CVFHLASYG+SGKEM++A + DEVN+ GTCN+LD+C ++GV RLV+
Sbjct: 96 RKKEDVGKALRGVDCVFHLASYGMSGKEMVQAGRADEVNINGTCNVLDACHEHGVRRLVY 155

Query: 337 ASSYNVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLH 158
S+YNVVFGG+ IV+GNE + YFP++ H+D+Y R K++AEQ+VLKSNGR KS +L+
Sbjct: 156 VSTYNVVFGGEPIVNGNEALPYFPVEDHVDAYARSKSIAEQLVLKSNGRQTKSDKSSRLY 215

Query: 157 TCAIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
TC+IRPA +YGP EE HLPR+L LA+ G+ IG P VK+DWVYVDNLV A
Sbjct: 216 TCSIRPAAIYGPGEERHLPRILSLAKLGLAFFKIGDPNVKSDWVYVDNLVLA 267


>tr|B4FG67|B4FG67_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 479

Score = 229 bits (585), Expect = 5e-59
Identities = 104/172 (60%), Positives = 136/172 (79%)
Frame = -2

Query: 517 KRKEETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVF 338
++K++ +A G +CVFHLASYG+SGKEM++ + DEVN+ GTCN+LD+C + GV RLV+
Sbjct: 67 RKKDDVRRAFRGVDCVFHLASYGMSGKEMVQTARSDEVNINGTCNVLDACHEQGVRRLVY 126

Query: 337 ASSYNVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLH 158
S+YNVVFGG+ IV+GNE + YFPI+ H+D+YGR K++AEQ+VLKSNGRP KS +L+
Sbjct: 127 VSTYNVVFGGKPIVNGNEALPYFPIEDHVDAYGRSKSVAEQLVLKSNGRPAKSDKSSRLY 186

Query: 157 TCAIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
TCAIRPA +YGP EE H PR+L LA+ G+ IG P VKTDWVY+DNLV A
Sbjct: 187 TCAIRPAAIYGPGEERHFPRILSLAKLGLAFFKIGDPGVKTDWVYIDNLVLA 238


>tr|O22813|O22813_ARATH Putative steroid dehydrogenase
(At2g33630/F4P9.40) OS=Arabidopsis thaliana GN=At2g33630
PE=2 SV=1
Length = 480

Score = 220 bits (561), Expect = 3e-56
Identities = 99/171 (57%), Positives = 137/171 (80%)
Frame = -2

Query: 514 RKEETDKALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFA 335
+K++ D AL GA+CV HLASYG+SGKEMLR + DEVN+ GTCN+L++ K+ + R+V+
Sbjct: 68 KKQDVDNALDGADCVLHLASYGMSGKEMLRFGRCDEVNINGTCNVLEAAFKHEITRIVYV 127

Query: 334 SSYNVVFGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHT 155
S+YNVVFGG+EI++GNE + YFP+D H+D+Y R K++AEQ+VLKSNGRP K+ G +++T
Sbjct: 128 STYNVVFGGKEILNGNEGLPYFPLDDHVDAYSRTKSIAEQLVLKSNGRPFKN-GGKRMYT 186

Query: 154 CAIRPAPVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
CAIRPA +YGP E+ HLPR++ L + G+ L IG P VK+DW+YV+NLV A
Sbjct: 187 CAIRPAAIYGPGEDRHLPRIVTLTKLGLALFKIGEPSVKSDWIYVENLVLA 237


>tr|Q4T1H0|Q4T1H0_TETNG Chromosome undetermined SCAF10591, whole
genome shotgun sequence. (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00008813001 PE=3 SV=1
Length = 376

Score = 177 bits (449), Expect = 3e-43
Identities = 87/165 (52%), Positives = 116/165 (70%)
Frame = -2

Query: 496 KALCGANCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSYNVV 317
KA+ GA CVFH+ASYG+SGKE L I+EVN+ GT NIL +C+++ V RLV+ S++NVV
Sbjct: 62 KAVAGATCVFHIASYGMSGKEQLNKHMIEEVNVRGTQNILKACIEHKVPRLVYTSTFNVV 121

Query: 316 FGGQEIVDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAIRPA 137
FGGQ I +G+E++ Y P+ H D Y R KALAE VLK+NG LK S G +CA+RPA
Sbjct: 122 FGGQVIENGDESLPYLPLHLHPDHYSRTKALAEMAVLKANGTALKDGS-GVFRSCALRPA 180

Query: 136 PVYGPHEEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
+YGP E+ HLPR++ +KG+ V G P ++V+VDNLV A
Sbjct: 181 GIYGPGEKRHLPRIVSYIEKGIFSFVYGEPSSLVEFVHVDNLVSA 225


>tr|A6MZK1|A6MZK1_ORYSI Putative nad (P)-dependent cholesterol
dehydrogenase (Fragment) OS=Oryza sativa subsp. indica
PE=2 SV=1
Length = 243

Score = 173 bits (439), Expect = 4e-42
Identities = 80/156 (51%), Positives = 112/156 (71%)
Frame = -2

Query: 478 NCVFHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSYNVVFGGQEI 299
+CVFHLASYG+S E ++A + D+VN+ GTCN+L++C +GV+ + S+YNVVF + I
Sbjct: 5 HCVFHLASYGVSRNETVQAARADKVNIDGTCNVLNACPYHGVKTRQYVSTYNVVFVREPI 64

Query: 298 VDGNENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAIRPAPVYGPH 119
V+GNE + FPI+ H+D+Y R K++AE +VL S R KS G +L+TC+IRPA +YGP
Sbjct: 65 VNGNEVLPDFPIEDHVDAYARNKSIAEPLVLTSTDRQTKSDKGSRLYTCSIRPAAIYGPR 124

Query: 118 EEHHLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNL 11
E+ HLPR+L LA G+ I P V ++WVYVDNL
Sbjct: 125 EDRHLPRILSLANLGLPFFAIVDPNVNSNWVYVDNL 160


>tr|A5HL68|A5HL68_ORYLA 3-beta-hydroxysteroid dehydrogenase 2
(Fragment) OS=Oryzias latipes GN=HSD3B2 PE=2 SV=1
Length = 155

Score = 166 bits (421), Expect = 5e-40
Identities = 82/156 (52%), Positives = 111/156 (71%)
Frame = -2

Query: 469 FHLASYGISGKEMLRARKIDEVNLTGTCNILDSCVKYGVERLVFASSYNVVFGGQEIVDG 290
FHLASYG+SG+E L + I+ VN+ GT NIL +CV++GV RLV+ S++NVVFGGQ I +G
Sbjct: 1 FHLASYGMSGREQLNKQLIEAVNVQGTQNILRACVEHGVSRLVYTSTFNVVFGGQVIENG 60

Query: 289 NENMGYFPIDTHLDSYGRCKALAEQIVLKSNGRPLKSKSGGKLHTCAIRPAPVYGPHEEH 110
+E++ Y P+ H D Y R K+LAE VLK+NG LK S G L TCA+RPA +YGP E+
Sbjct: 61 DESLPYLPLHLHPDHYSRTKSLAEMAVLKANGTVLKEGS-GLLRTCALRPAGIYGPGEQR 119

Query: 109 HLPRLLDLAQKGMLLCVIGGPEVKTDWVYVDNLVQA 2
HLPR++ ++G+ V G P ++V+VDNLV A
Sbjct: 120 HLPRIVGYIERGVFRFVYGSPHSLVEFVHVDNLVSA 155