BP914325
Clone id YMU001_000057_F06
Library
Length 588
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCATCCAAAGCAACTGCCAACATATGCTTAACATCATTATTCGTTCTCTGTTTCAACGCT
AAGCTGTATCTTCTCAATAATCTTGTTCAGAAATGGAGCACTTGATCTGTATGAAGCATC
CGTAAAACAAGATCGTCCCTCTTCAGCTGCATGACTGAGCTGTGGATCCAAAGGCACTCT
ACCGAGAAAAGGAACCTTCATATCCTTAGCCATCTTTTCGGCTCCTCCACCTAGAGCATA
AAAAACTTCCGAATACGCATAGATTGACTCCTGAGAGCTCTGCAAAAGCTCTCTTAAAAC
AGCTTCTGTCACATCCTCTTCCACACCATCATCCTTAATCTTCTTAAATGTCAAACTGGA
TAATGGCTGCAATAAACCGCTCATGTTTTCAACTACACCCAGAACTGGAATCCCCACCTT
CTTGCAAAAATTAATTTCTTTCCGCACATCAATAATCGCTACATCTTGCGGTGTTGTAAC
AACAATAGCTCCATCTACATTGGTTGCTTTCAAATATTGCGCTATAGAGATGTGTTCATC
AGAAGTCCCTGGCGGGGCATCCACTATCAAGTAATCAAGATCACCCCA
■■Homology search results ■■ -
sp_hit_id Q8T2F3
Definition sp|Q8T2F3|NUBP1_DICDI Nucleotide-binding protein 1 homolog OS=Dictyostelium discoideum
Align length 175
Score (bit) 164.0
E-value 4.0e-40
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914325|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_F06.
(588 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8T2F3|NUBP1_DICDI Nucleotide-binding protein 1 homolog OS=Di... 164 4e-40
sp|Q9R060|NUBP1_MOUSE Nucleotide-binding protein 1 OS=Mus muscul... 152 1e-36
sp|Q5I0L4|NUBP1_RAT Nucleotide binding protein 1 OS=Rattus norve... 149 1e-35
sp|Q24K00|NUBP1_BOVIN Nucleotide-binding protein 1 OS=Bos taurus... 149 1e-35
sp|Q0UI56|NBP35_PHANO Cytosolic Fe-S cluster assembling factor N... 147 3e-35
sp|P53384|NUBP1_HUMAN Nucleotide-binding protein 1 OS=Homo sapie... 147 5e-35
sp|Q5KGM5|NBP35_CRYNE Cytosolic Fe-S cluster assembling factor N... 146 9e-35
sp|O94442|NBP35_SCHPO Cytosolic Fe-S cluster assembling factor N... 143 6e-34
sp|Q4WZS2|NBP35_ASPFU Cytosolic Fe-S cluster assembling factor n... 143 7e-34
sp|Q7S8Z0|NBP35_NEUCR Cytosolic Fe-S cluster assembling factor n... 141 3e-33
sp|A1C7T4|NBP35_ASPCL Cytosolic Fe-S cluster assembling factor n... 140 4e-33
sp|Q874M2|NBP35_CANGA Cytosolic Fe-S cluster assembling factor N... 139 8e-33
sp|Q4HZ34|NBP35_GIBZE Cytosolic Fe-S cluster assembling factor N... 139 1e-32
sp|Q5BBC5|NBP35_EMENI Cytosolic Fe-S cluster assembling factor n... 139 1e-32
sp|Q1EAU8|NBP35_COCIM Cytosolic Fe-S cluster assembling factor N... 139 1e-32
sp|Q6C7A6|NBP35_YARLI Cytosolic Fe-S cluster assembling factor N... 138 2e-32
sp|Q6BTZ6|NBP35_DEBHA Cytosolic Fe-S cluster assembling factor N... 138 2e-32
sp|Q2UDE2|NBP35_ASPOR Cytosolic Fe-S cluster assembling factor n... 138 2e-32
sp|Q59MP1|NBP35_CANAL Cytosolic Fe-S cluster assembling factor N... 137 4e-32
sp|Q0CVD6|NBP35_ASPTN Cytosolic Fe-S cluster assembling factor n... 136 7e-32
sp|Q6CMN0|NBP35_KLULA Cytosolic Fe-S cluster assembling factor N... 135 1e-31
sp|P52920|NBP35_YEAST Cytosolic Fe-S cluster assembling factor N... 135 2e-31
sp|Q2H317|NBP35_CHAGB Cytosolic Fe-S cluster assembling factor N... 135 2e-31
sp|Q5ZKV4|NUBP2_CHICK Nucleotide-binding protein 2 OS=Gallus gal... 133 8e-31
sp|Q6FPP7|CFD1_CANGA Cytosolic Fe-S cluster assembling factor CF... 128 2e-29
sp|Q3MHY6|NUBP2_BOVIN Nucleotide-binding protein 2 OS=Bos taurus... 127 4e-29
sp|Q754X6|NBP35_ASHGO Cytosolic Fe-S cluster assembling factor N... 127 5e-29
sp|Q6CQV4|CFD1_KLULA Cytosolic Fe-S cluster assembling factor CF... 123 6e-28
sp|Q68FS1|NUBP2_RAT Nucleotide-binding protein 2 OS=Rattus norve... 122 1e-27
sp|P40558|CFD1_YEAST Cytosolic Fe-S cluster assembling factor CF... 121 2e-27

>sp|Q8T2F3|NUBP1_DICDI Nucleotide-binding protein 1 homolog
OS=Dictyostelium discoideum GN=nubp1 PE=3 SV=1
Length = 315

Score = 164 bits (414), Expect = 4e-40
Identities = 82/175 (46%), Positives = 111/175 (63%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
W DLDYL++D PPGTSDEH+SI QYLK +N+ GA++VT+PQDVA+IDVRKEINFCKKVG+
Sbjct: 166 WNDLDYLVIDTPPGTSDEHLSIVQYLKTSNLSGAVIVTSPQDVALIDVRKEINFCKKVGV 225

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
P++GVVENMSG + P + ++ES ++F
Sbjct: 226 PIIGVVENMSGFVCP---------------------------KCNKES-----QIFIPTT 253

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQ 64
GGAEKM++DM VPFLGR+P+DP ++ + +EG+S + N I KI+
Sbjct: 254 GGAEKMSQDMNVPFLGRIPIDPLIARSCDEGKSYLITHPNSEATKQYNLIFNKIK 308


>sp|Q9R060|NUBP1_MOUSE Nucleotide-binding protein 1 OS=Mus musculus
GN=Nubp1 PE=1 SV=1
Length = 320

Score = 152 bits (384), Expect = 1e-36
Identities = 76/175 (43%), Positives = 109/175 (62%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WGD+DYLIVD PPGTSDEH+S+ QYL A ++DGA+++TTPQ+VA+ DVRKEI+FC KV +
Sbjct: 162 WGDVDYLIVDTPPGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKL 221

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
P++GVVENMSG + P K K + S++F
Sbjct: 222 PIIGVVENMSGFICP-------KCKKE-------------------------SQIFPPTT 249

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQ 64
GGAE M +D+++P LG+VPLDP + + ++G+S F +A + II++I+
Sbjct: 250 GGAEAMCQDLRIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYRSIIQRIR 304


>sp|Q5I0L4|NUBP1_RAT Nucleotide binding protein 1 OS=Rattus
norvegicus GN=Nubp1 PE=2 SV=1
Length = 320

Score = 149 bits (376), Expect = 1e-35
Identities = 74/175 (42%), Positives = 108/175 (61%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WGD+DYL++D PPGTSDEH+S+ QYL A ++DGA+++TTPQ+VA+ DVRKEI+FC KV +
Sbjct: 162 WGDVDYLVIDTPPGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKL 221

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
P++GVVENMSG + P K K + S++F
Sbjct: 222 PIIGVVENMSGFICP-------KCKRE-------------------------SQIFPPTT 249

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQ 64
GGAE M + +K+P LG+VPLDP + + ++G+S F +A + II++I+
Sbjct: 250 GGAEAMCQALKIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYKSIIQRIR 304


>sp|Q24K00|NUBP1_BOVIN Nucleotide-binding protein 1 OS=Bos taurus
GN=NUBP1 PE=2 SV=1
Length = 320

Score = 149 bits (376), Expect = 1e-35
Identities = 73/175 (41%), Positives = 106/175 (60%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYLIVD PPGTSDEH+S+ QYL A ++DGA+++TTPQ+V++ DVRKEI+FC KV +
Sbjct: 162 WGEVDYLIVDTPPGTSDEHLSVVQYLTAAHIDGAVIITTPQEVSLQDVRKEISFCHKVKL 221

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
P++GVVENMSG + P S++F
Sbjct: 222 PIIGVVENMSGFICP--------------------------------KCQKESQIFPPTT 249

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQ 64
GGAE M +D+K+P LG+VPLDP++ + ++G+S +A + II++IQ
Sbjct: 250 GGAEAMCQDLKIPLLGKVPLDPRIGKSCDKGQSFLVEAPDSPATVAYRSIIQRIQ 304


>sp|Q0UI56|NBP35_PHANO Cytosolic Fe-S cluster assembling factor
NBP35 OS=Phaeosphaeria nodorum GN=NBP35 PE=3 SV=2
Length = 336

Score = 147 bits (372), Expect = 3e-35
Identities = 75/181 (41%), Positives = 109/181 (60%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG+LD+LIVD PPGTSDEH+S+ +LKA+ VDGA++VTTPQ+VA++DVRKEI+FC+K I
Sbjct: 180 WGELDFLIVDTPPGTSDEHLSVNSFLKASGVDGAVLVTTPQEVALLDVRKEIDFCRKASI 239

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
P+LG+VENMSG + P G + + S++F A
Sbjct: 240 PILGIVENMSGFVCP------------GCKHE--------------------SQIFRAST 267

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQLSVET 49
GGA K+AK+ +PFLG VPLDP++ A + G S T + + ++ ++ + +
Sbjct: 268 GGARKLAKEENIPFLGAVPLDPRIGMACDYGESFLTAYPDSPACAAIRDVVRRVGVEMGL 327

Query: 48 E 46
E
Sbjct: 328 E 328


>sp|P53384|NUBP1_HUMAN Nucleotide-binding protein 1 OS=Homo sapiens
GN=NUBP1 PE=1 SV=1
Length = 320

Score = 147 bits (370), Expect = 5e-35
Identities = 75/175 (42%), Positives = 107/175 (61%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYLIVD PPGTSDEH+S+ +YL ++DGA+++TTPQ++++ DVRKEINFC+KV +
Sbjct: 162 WGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQELSLQDVRKEINFCRKVKL 221

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
P++GVVENMS + P K K + S++F
Sbjct: 222 PIIGVVENMSPFICP-------KCKKE-------------------------SQIFPPTT 249

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQ 64
GGAE M +D++VP LGRVPLDP + ++G+S F DA + II++IQ
Sbjct: 250 GGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQ 304


>sp|Q5KGM5|NBP35_CRYNE Cytosolic Fe-S cluster assembling factor
NBP35 OS=Cryptococcus neoformans GN=NBP35 PE=3 SV=1
Length = 336

Score = 146 bits (368), Expect = 9e-35
Identities = 76/181 (41%), Positives = 108/181 (59%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WGDLDY++VD PPGTSDEH+SI QYLK +DGA++VTTPQ+VA+ DVRKEI+FCKKVGI
Sbjct: 188 WGDLDYMVVDTPPGTSDEHLSIVQYLKEAGIDGAVLVTTPQEVALQDVRKEIDFCKKVGI 247

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
P+LG+VENMSG + P K++ S++F
Sbjct: 248 PILGLVENMSGFVCP-------NCKNE-------------------------SQIFAPTT 275

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQLSVET 49
GGAE M K++ + LG+VPLDP++ ++G S + + I+++I+ ++
Sbjct: 276 GGAEAMGKELGIELLGKVPLDPRIGMTCDQGMSFLDEYPESPATMAYLDIVQRIREILDD 335

Query: 48 E 46
E
Sbjct: 336 E 336


>sp|O94442|NBP35_SCHPO Cytosolic Fe-S cluster assembling factor
NBP35 OS=Schizosaccharomyces pombe GN=nbp35 PE=2 SV=1
Length = 317

Score = 143 bits (361), Expect = 6e-34
Identities = 74/179 (41%), Positives = 105/179 (58%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
W +LDYLIVD PPGTSDEH+S+ Q+ K + +DGA+VVTTPQ+VA+ DVRKEI+FC+K I
Sbjct: 168 WENLDYLIVDTPPGTSDEHLSLVQFFKNSGIDGAVVVTTPQEVALQDVRKEIDFCRKASI 227

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
P+LG+VENMSG + P S S +F
Sbjct: 228 PILGLVENMSGFVCP--------------------------------SCKGKSNIFTITT 255

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQLSVE 52
GG E +AK+M +PFLG++PLDP ++ + + G+S + ++ + II KI S++
Sbjct: 256 GGGEALAKEMGLPFLGKIPLDPLIARSCDFGKSFIDECPESPASEIIIDIINKIDESLQ 314


>sp|Q4WZS2|NBP35_ASPFU Cytosolic Fe-S cluster assembling factor
nbp35 OS=Aspergillus fumigatus GN=nbp35 PE=3 SV=1
Length = 345

Score = 143 bits (360), Expect = 7e-34
Identities = 81/178 (45%), Positives = 107/178 (60%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WGDLDYLIVD PPGTSDEH+S+ LK + VDGA++VTTPQ+V+++DVRKEI+FC+K GI
Sbjct: 183 WGDLDYLIVDTPPGTSDEHLSVNSLLKESGVDGAVIVTTPQEVSLLDVRKEIDFCRKAGI 242

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
+LG+VENM G + P S T SE+F A
Sbjct: 243 RILGLVENMRGFVCPGCSNT--------------------------------SEIFRATT 270

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQLSV 55
GG +++AK M +PFLG VPLDP++ A + G S F D S A +K I+++ SV
Sbjct: 271 GGGKRLAKKMGIPFLGSVPLDPRVGMACDYGES-FVDNFPDSPA---SKAIKQVVRSV 324


>sp|Q7S8Z0|NBP35_NEUCR Cytosolic Fe-S cluster assembling factor
nbp-35 OS=Neurospora crassa GN=nbp-35 PE=3 SV=1
Length = 344

Score = 141 bits (355), Expect = 3e-33
Identities = 72/155 (46%), Positives = 98/155 (63%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WGDLD+L+VD PPGTSDEH+S+ YLK + +DGA++VTTPQ+V+++DVRKEI+FC+K GI
Sbjct: 185 WGDLDFLLVDTPPGTSDEHLSVNTYLKKSGIDGAVMVTTPQEVSLLDVRKEIDFCRKAGI 244

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQESIYAYSEVFYALG 229
VLG+VENMSG + P + + ES E+F A
Sbjct: 245 KVLGLVENMSGFVCP---------------------------KCTHES-----EIFKATT 272

Query: 228 GGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCF 124
GG K+A++M + FLG VPLDP++ A + G S F
Sbjct: 273 GGGRKLAEEMGIAFLGSVPLDPRIGMACDYGESFF 307


tr_hit_id A9P0N7
Definition tr|A9P0N7|A9P0N7_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 181
Score (bit) 256.0
E-value 7.0e-67
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914325|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_F06.
(588 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9P0N7|A9P0N7_PICSI Putative uncharacterized protein OS=Picea... 256 7e-67
tr|B6TDA7|B6TDA7_MAIZE Nucleotide-binding protein 1 OS=Zea mays ... 225 1e-57
tr|B4FU40|B4FU40_MAIZE Putative uncharacterized protein OS=Zea m... 225 1e-57
tr|B6TEA3|B6TEA3_MAIZE Nucleotide-binding protein 1 OS=Zea mays ... 224 4e-57
tr|B4G1E5|B4G1E5_MAIZE Putative uncharacterized protein OS=Zea m... 223 6e-57
tr|B7FKL5|B7FKL5_MEDTR Putative uncharacterized protein OS=Medic... 222 1e-56
tr|A9SAX9|A9SAX9_PHYPA Predicted protein OS=Physcomitrella paten... 220 5e-56
tr|Q7X7U0|Q7X7U0_ORYSJ OJ000223_09.9 protein (OSJNBa0081L15.19 p... 218 2e-55
tr|B8AVT1|B8AVT1_ORYSI Putative uncharacterized protein OS=Oryza... 218 2e-55
tr|B7F661|B7F661_ORYSJ cDNA clone:J013156K04, full insert sequen... 218 2e-55
tr|A3AV07|A3AV07_ORYSJ Putative uncharacterized protein OS=Oryza... 218 2e-55
tr|A2X6V5|A2X6V5_ORYSI Putative uncharacterized protein OS=Oryza... 218 2e-55
tr|Q6K5H0|Q6K5H0_ORYSJ Putative nucleotide binding protein (Puta... 218 3e-55
tr|Q9C5E1|Q9C5E1_ARATH Putative nucleotide-binding protein OS=Ar... 214 2e-54
tr|Q8H1Q2|Q8H1Q2_ARATH Nucleotide-binding protein OS=Arabidopsis... 214 2e-54
tr|Q8GUW6|Q8GUW6_CYPPP Nucleotide binding protein OS=Cypripedium... 210 4e-53
tr|Q9FI52|Q9FI52_ARATH Nucleotide-binding protein OS=Arabidopsis... 194 4e-48
tr|A7PLU7|A7PLU7_VITVI Chromosome chr14 scaffold_21, whole genom... 192 2e-47
tr|A4RRN3|A4RRN3_OSTLU Predicted protein OS=Ostreococcus lucimar... 177 3e-43
tr|A7RUD5|A7RUD5_NEMVE Predicted protein OS=Nematostella vectens... 158 2e-37
tr|B6MPX5|B6MPX5_BRAFL Putative uncharacterized protein OS=Branc... 157 6e-37
tr|Q640D6|Q640D6_XENLA LOC494723 protein (Fragment) OS=Xenopus l... 156 9e-37
tr|Q3KQF0|Q3KQF0_XENLA LOC494723 protein OS=Xenopus laevis GN=nu... 156 9e-37
tr|B8BZX8|B8BZX8_THAPS Putative uncharacterized protein OS=Thala... 155 1e-36
tr|Q52KS7|Q52KS7_XENLA LOC494723 protein (Fragment) OS=Xenopus l... 154 5e-36
tr|Q6P298|Q6P298_DANRE Nubp1 protein (Fragment) OS=Danio rerio G... 153 8e-36
tr|Q561P6|Q561P6_DANRE Nucleotide binding protein 1 (MinD homolo... 152 1e-35
tr|A6ML04|A6ML04_CALJA Nucleotide binding protein 1-like protein... 151 3e-35
tr|Q5I050|Q5I050_XENLA LOC496286 protein OS=Xenopus laevis GN=LO... 150 5e-35
tr|Q4S9J1|Q4S9J1_TETNG Chromosome undetermined SCAF14696, whole ... 150 5e-35

>tr|A9P0N7|A9P0N7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 361

Score = 256 bits (654), Expect = 7e-67
Identities = 127/181 (70%), Positives = 151/181 (83%), Gaps = 2/181 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG+LDYL+VDAPPGTSDEHISIAQYLKATNVDGA++VTTPQ+V+IIDVRKEINFCKKVGI
Sbjct: 180 WGELDYLVVDAPPGTSDEHISIAQYLKATNVDGALIVTTPQEVSIIDVRKEINFCKKVGI 239

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
PVLGVVENMSG+ QP+SS FKKI +DG EEDVTE L+ L S S++A +E+F+
Sbjct: 240 PVLGVVENMSGIQQPISSFIFKKIAEDGKEEDVTEETLKSLQMHSPHLLSLFASTEIFHV 299

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKIQLSV 55
GGGAEKMA +M VPFLG+VP+D +LS AAEEGRSCFTD +SSA L +IIEK+ ++
Sbjct: 300 SGGGAEKMAHEMHVPFLGKVPIDLELSKAAEEGRSCFTDPKCKSSASALQRIIEKLLKNI 359

Query: 54 E 52
E
Sbjct: 360 E 360


>tr|B6TDA7|B6TDA7_MAIZE Nucleotide-binding protein 1 OS=Zea mays
PE=2 SV=1
Length = 258

Score = 225 bits (574), Expect = 1e-57
Identities = 114/176 (64%), Positives = 139/176 (78%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYL+VDAPPGTSDEHISI QYL+AT +DGAI+VTTPQ V++IDVRKEINFCKKVG+
Sbjct: 80 WGEIDYLVVDAPPGTSDEHISIVQYLQATGIDGAIIVTTPQQVSLIDVRKEINFCKKVGV 139

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
PVLGVVENMSGL QPLS L+F K + G E D TE L + + + E S+ A SEVF +
Sbjct: 140 PVLGVVENMSGLRQPLSDLSFVKPGEAG-ETDATEWALNYIKEKAPELLSVMACSEVFDS 198

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGAEKM ++M VPFLG+VP+DPQL AAEEGRSCF+D +SAP L I++K+
Sbjct: 199 SKGGAEKMCREMGVPFLGKVPMDPQLCKAAEEGRSCFSDQKCGASAPALQSIVKKL 254


>tr|B4FU40|B4FU40_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 348

Score = 225 bits (574), Expect = 1e-57
Identities = 114/176 (64%), Positives = 139/176 (78%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYL+VDAPPGTSDEHISI QYL+AT +DGAI+VTTPQ V++IDVRKEINFCKKVG+
Sbjct: 170 WGEIDYLVVDAPPGTSDEHISIVQYLQATGIDGAIIVTTPQQVSLIDVRKEINFCKKVGV 229

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
PVLGVVENMSGL QPLS L+F K + G E D TE L + + + E S+ A SEVF +
Sbjct: 230 PVLGVVENMSGLRQPLSDLSFVKPGEAG-ETDATEWALNYIKEKAPELLSVMACSEVFDS 288

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGAEKM ++M VPFLG+VP+DPQL AAEEGRSCF+D +SAP L I++K+
Sbjct: 289 SKGGAEKMCREMGVPFLGKVPMDPQLCKAAEEGRSCFSDQKCGASAPALQSIVKKL 344


>tr|B6TEA3|B6TEA3_MAIZE Nucleotide-binding protein 1 OS=Zea mays
PE=2 SV=1
Length = 348

Score = 224 bits (570), Expect = 4e-57
Identities = 113/176 (64%), Positives = 137/176 (77%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYL+VDAPPGTSDEHISI QYL+AT +DGAI+VTTPQ V++IDVRKEINFCKKVG+
Sbjct: 170 WGEIDYLVVDAPPGTSDEHISIVQYLQATGIDGAIIVTTPQQVSLIDVRKEINFCKKVGV 229

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
PVLGVVENMSGL QPLS L F K+ D+ + D TE L + + + E S+ A SEVF +
Sbjct: 230 PVLGVVENMSGLRQPLSDLRFIKL-DEAGKTDATEWALNYIKEKAPELLSVMACSEVFDS 288

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGAEKM +M VPFLG+VP+DPQL AAEEGRSCF D +SAP L I++K+
Sbjct: 289 SKGGAEKMCHEMGVPFLGKVPMDPQLCKAAEEGRSCFADQKCSASAPALRNIVKKL 344


>tr|B4G1E5|B4G1E5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 348

Score = 223 bits (568), Expect = 6e-57
Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYL+VDAPPGTSDEHISI QYL+AT +DGAI+VTTPQ V++IDVRKEINFCKKVG+
Sbjct: 170 WGEIDYLVVDAPPGTSDEHISIVQYLQATGIDGAIIVTTPQQVSLIDVRKEINFCKKVGV 229

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
PVLGVVENMSGL QPLS L F K D+ + D TE L + + + E S+ A SEVF +
Sbjct: 230 PVLGVVENMSGLRQPLSDLRFIK-SDEAGKTDATEWALNYIKEKAPELLSVMACSEVFDS 288

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGAEKM +M VPFLG+VP+DPQL AAEEGRSCF D +SAP L I++K+
Sbjct: 289 SKGGAEKMCHEMGVPFLGKVPMDPQLCKAAEEGRSCFADQKCSASAPALRNIVKKL 344


>tr|B7FKL5|B7FKL5_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 355

Score = 222 bits (566), Expect = 1e-56
Identities = 113/176 (64%), Positives = 137/176 (77%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG+LD+LIVDAPPGTSDEHISI Q L A NVDGAI+VTTPQ V++IDV+KE+NFCKKVG+
Sbjct: 166 WGELDFLIVDAPPGTSDEHISIVQCLDAANVDGAIIVTTPQQVSLIDVKKEVNFCKKVGV 225

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
VLGVVENMSGL QP+S+L F KI D+G +DVTE + + + + E ++ A SEVF +
Sbjct: 226 KVLGVVENMSGLSQPISNLKFMKITDNGEMKDVTEWISEYMKEKAPEMLNLIACSEVFDS 285

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGGA K+ +M VPFLG+VPLDPQL AAEEGRSCF D SAP L KII+K+
Sbjct: 286 SGGGALKVCNEMAVPFLGKVPLDPQLCKAAEEGRSCFADKDCVVSAPALQKIIDKL 341


>tr|A9SAX9|A9SAX9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_182966 PE=4 SV=1
Length = 360

Score = 220 bits (560), Expect = 5e-56
Identities = 113/176 (64%), Positives = 131/176 (74%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WGDLDYL+VDAPPGTSDEHISI QYLKA+NVDGAI+VTTPQ+V++IDVRKEINFCKKVGI
Sbjct: 173 WGDLDYLVVDAPPGTSDEHISIMQYLKASNVDGAIIVTTPQEVSLIDVRKEINFCKKVGI 232

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
VLGVVENMS L Q L S FK + G E+DVT VL L + S + + VFY
Sbjct: 233 KVLGVVENMSELRQQLESAEFKSVDAQGEEQDVTNEVLDVLKSHAPHLLSSFVATSVFYG 292

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGAEKM K +KVPFLGR+PLDP+L AA+EGRSCF D +SA L +I +I
Sbjct: 293 GAGGAEKMCKQIKVPFLGRIPLDPKLGKAADEGRSCFGDRDCSASAAALRTVINRI 348


>tr|Q7X7U0|Q7X7U0_ORYSJ OJ000223_09.9 protein (OSJNBa0081L15.19
protein) OS=Oryza sativa subsp. japonica
GN=OJ000223_09.9 PE=4 SV=2
Length = 346

Score = 218 bits (555), Expect = 2e-55
Identities = 110/176 (62%), Positives = 135/176 (76%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYL+VDAPPGTSDEHISI QYL+ +DGAI+VTTPQ V++IDV+KEINFCKKVG+
Sbjct: 168 WGEIDYLVVDAPPGTSDEHISIVQYLQIAGIDGAIIVTTPQQVSLIDVKKEINFCKKVGV 227

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
PVLGVVENMSGL Q S + F K + G E D TE L + + + E S+ A SEVF +
Sbjct: 228 PVLGVVENMSGLRQAFSDMKFVKPSEAG-ETDATEWALNYIKEKAPELLSVVACSEVFDS 286

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGAEKM ++M+VPFLG+VP+DPQL AAEEGRSCFTD +SAP L II+K+
Sbjct: 287 SKGGAEKMCQEMEVPFLGKVPMDPQLCKAAEEGRSCFTDQKCSASAPALKSIIKKL 342


>tr|B8AVT1|B8AVT1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_16378 PE=4 SV=1
Length = 346

Score = 218 bits (555), Expect = 2e-55
Identities = 110/176 (62%), Positives = 135/176 (76%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYL+VDAPPGTSDEHISI QYL+ +DGAI+VTTPQ V++IDV+KEINFCKKVG+
Sbjct: 168 WGEIDYLVVDAPPGTSDEHISIVQYLQIAGIDGAIIVTTPQQVSLIDVKKEINFCKKVGV 227

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
PVLGVVENMSGL Q S + F K + G E D TE L + + + E S+ A SEVF +
Sbjct: 228 PVLGVVENMSGLRQAFSDMKFVKPSEAG-ETDATEWALNYIKEKAPELLSVVACSEVFDS 286

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGAEKM ++M+VPFLG+VP+DPQL AAEEGRSCFTD +SAP L II+K+
Sbjct: 287 SKGGAEKMCQEMEVPFLGKVPMDPQLCKAAEEGRSCFTDQKCSASAPALKSIIKKL 342


>tr|B7F661|B7F661_ORYSJ cDNA clone:J013156K04, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 358

Score = 218 bits (555), Expect = 2e-55
Identities = 110/176 (62%), Positives = 135/176 (76%), Gaps = 2/176 (1%)
Frame = -1

Query: 588 WGDLDYLIVDAPPGTSDEHISIAQYLKATNVDGAIVVTTPQDVAIIDVRKEINFCKKVGI 409
WG++DYL+VDAPPGTSDEHISI QYL+ +DGAI+VTTPQ V++IDV+KEINFCKKVG+
Sbjct: 180 WGEIDYLVVDAPPGTSDEHISIVQYLQIAGIDGAIIVTTPQQVSLIDVKKEINFCKKVGV 239

Query: 408 PVLGVVENMSGLLQPLSSLTFKKIKDDGVEEDVTEAVLRELLQSSQE--SIYAYSEVFYA 235
PVLGVVENMSGL Q S + F K + G E D TE L + + + E S+ A SEVF +
Sbjct: 240 PVLGVVENMSGLRQAFSDMKFVKPSEAG-ETDATEWALNYIKEKAPELLSVVACSEVFDS 298

Query: 234 LGGGAEKMAKDMKVPFLGRVPLDPQLSHAAEEGRSCFTDASYRSSAPFLNKIIEKI 67
GGAEKM ++M+VPFLG+VP+DPQL AAEEGRSCFTD +SAP L II+K+
Sbjct: 299 SKGGAEKMCQEMEVPFLGKVPMDPQLCKAAEEGRSCFTDQKCSASAPALKSIIKKL 354