BP914330
Clone id YMU001_000057_F11
Library
Length 591
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GACAAGGGAACTGTGTACATCTTTGGTGCGCGGACTATAGGTTCAAATAGCGCAGACACT
CATGGGGTGGCATCTCCCAATCGCAATCTGAATTCGACCTTGTCATTCATAAAAGGTGTC
CTACCAAAATATTTTAGATCAGAGTGGTCATATGCGCAGTTTAAGCTCTCGGAGGAGATG
AAGTCCGTTATTGCCCTTGGACAAGATAACCACAGCATTTTTGTGCTAGGTACAGATGGC
AGTTTCTACAAGTTTTCATTTGATTCTGAGCATGGAGGAGATGTGAAGCAGCTGGAGTCT
TTTAATTTTTTGAAAGCAAGGGAACAGAAGGTTGATTAAACAATCCTTTAGTCGACGAGT
CCACGAACATAGTTATCATTTGTAAGATGGGCAATTACCAAAAGTTAAATTCTTAGGGGG
CGAATAATCACTCCACATGGTATCAATGGTCAAGGAGACAAGGGAATATTGCTTCCCTTT
GTAATTTACTGTTTGTCTGCCATTTTATTAGTAGACAAATTCGTGACCCCACATTTGTTA
TACGAGAGAATAATCCAGTCATTCTCATGATGGCTTTGTATCATGTATATG
■■Homology search results ■■ -
sp_hit_id Q640T2
Definition sp|Q640T2|WIPI3_XENTR WD repeat domain phosphoinositide-interacting protein 3 OS=Xenopus tropicalis
Align length 111
Score (bit) 58.9
E-value 2.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914330|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_F11.
(591 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q640T2|WIPI3_XENTR WD repeat domain phosphoinositide-interact... 59 2e-08
sp|Q7ZUW6|WIPI3_DANRE WD repeat domain phosphoinositide-interact... 59 2e-08
sp|Q68F45|WIPI3_XENLA WD repeat domain phosphoinositide-interact... 59 2e-08
sp|Q5ZL16|WIPI3_CHICK WD repeat domain phosphoinositide-interact... 57 5e-08
sp|Q5R7W0|WIPI3_PONAB WD repeat domain phosphoinositide-interact... 56 1e-07
sp|Q9CR39|WIPI3_MOUSE WD repeat domain phosphoinositide-interact... 56 1e-07
sp|Q5MNZ6|WIPI3_HUMAN WD repeat domain phosphoinositide-interact... 56 1e-07
sp|Q54NA2|ATG18_DICDI Autophagy-related protein 18 OS=Dictyostel... 50 9e-06
sp|A1DE24|ATG18_NEOFI Autophagy-related protein 18 OS=Neosartory... 42 0.002
sp|Q4WVD0|ATG18_ASPFU Autophagy-related protein 18 OS=Aspergillu... 42 0.002
sp|Q6DCV0|WIPI4_XENLA WD repeat domain phosphoinositide-interact... 41 0.005
sp|Q4P4N1|ATG18_USTMA Autophagy-related protein 18 OS=Ustilago m... 41 0.005
sp|Q1DKJ3|ATG18_COCIM Autophagy-related protein 18 OS=Coccidioid... 38 0.033
sp|A1CBB8|ATG18_ASPCL Autophagy-related protein 18 OS=Aspergillu... 38 0.044
sp|A6SJ85|ATG18_BOTFB Autophagy-related protein 18 OS=Botryotini... 37 0.057
sp|A7EW77|ATG18_SCLS1 Autophagy-related protein 18 OS=Sclerotini... 37 0.075
sp|Q5BH53|ATG18_EMENI Autophagy-related protein 18 OS=Emericella... 37 0.075
sp|Q96U88|ATG18_NEUCR Autophagy-related protein 18 OS=Neurospora... 36 0.13
sp|A2RAG5|ATG18_ASPNC Autophagy-related protein 18 OS=Aspergillu... 36 0.17
sp|Q6BUX9|HSV2_DEBHA SVP1-like protein 2 OS=Debaryomyces hanseni... 35 0.22
sp|Q2U6D5|ATG18_ASPOR Autophagy-related protein 18 OS=Aspergillu... 35 0.22
sp|Q524W4|ATG18_MAGGR Autophagy-related protein 18 OS=Magnaporth... 35 0.37
sp|Q0CW30|ATG18_ASPTN Autophagy-related protein 18 OS=Aspergillu... 35 0.37
sp|Q9HDZ7|ATG18_SCHPO Autophagy-related protein 18 OS=Schizosacc... 33 0.82
sp|A7KAM8|ATG18_PENCH Autophagy-related protein 18 OS=Penicilliu... 33 0.82
sp|A6QTX7|ATG18_AJECN Autophagy-related protein 18 OS=Ajellomyce... 33 1.4
sp|Q8X1F5|ATG18_PICPA Autophagy-related protein 18 OS=Pichia pas... 32 1.8
sp|Q5ABA6|ATG18_CANAL Autophagy-related protein 18 OS=Candida al... 32 2.4
sp|Q8CNE6|MOAA_STAES Molybdenum cofactor biosynthesis protein A ... 31 4.1
sp|Q5HLY1|MOAA_STAEQ Molybdenum cofactor biosynthesis protein A ... 31 4.1

>sp|Q640T2|WIPI3_XENTR WD repeat domain phosphoinositide-interacting
protein 3 OS=Xenopus tropicalis GN=wdr45l PE=2 SV=1
Length = 344

Score = 58.9 bits (141), Expect = 2e-08
Identities = 36/111 (32%), Positives = 57/111 (51%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLNSTLSFIKGVLPKYFRSEWSYAQFKLSEEM 180
D GTV+IF A P RN S+L+ LPKYF S+WS+++F++
Sbjct: 250 DHGTVHIFAAE-------------DPKRNKQSSLASAS-FLPKYFSSKWSFSKFQVPSGS 295

Query: 181 KSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQKV 333
V A G + +S+ + DGS+YKF F+ + G+ + FL+ + K+
Sbjct: 296 PCVCAFGTEPNSVIAICADGSYYKFQFNPK--GECTRDVYAQFLEMTDDKL 344


>sp|Q7ZUW6|WIPI3_DANRE WD repeat domain phosphoinositide-interacting
protein 3 OS=Danio rerio GN=wdr45l PE=2 SV=1
Length = 344

Score = 58.9 bits (141), Expect = 2e-08
Identities = 35/111 (31%), Positives = 58/111 (52%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLNSTLSFIKGVLPKYFRSEWSYAQFKLSEEM 180
D GTV+IF A P RN S+L+ LPKYF S+WS+++F++
Sbjct: 250 DHGTVHIFAAE-------------DPKRNKQSSLASAS-FLPKYFSSKWSFSKFQVPSGS 295

Query: 181 KSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQKV 333
V A G + +++ + DGS+YKF F+ + G+ + FL+ ++K+
Sbjct: 296 PCVCAFGTEPNAVIAICADGSYYKFLFNPK--GECSRDVYAQFLEMTDEKI 344


>sp|Q68F45|WIPI3_XENLA WD repeat domain phosphoinositide-interacting
protein 3 OS=Xenopus laevis GN=wdr45l PE=2 SV=1
Length = 344

Score = 58.5 bits (140), Expect = 2e-08
Identities = 35/111 (31%), Positives = 57/111 (51%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLNSTLSFIKGVLPKYFRSEWSYAQFKLSEEM 180
D GTV+IF A P RN S+L+ LPKYF S+WS+++F++
Sbjct: 250 DHGTVHIFAAE-------------DPKRNKQSSLASAS-FLPKYFSSKWSFSKFQVPSGS 295

Query: 181 KSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQKV 333
+ A G + +S+ + DGS+YKF F+ + G+ + FL+ + K+
Sbjct: 296 PCICAFGTEPNSVIAICADGSYYKFQFNPK--GECTRDVYAQFLEMTDDKL 344


>sp|Q5ZL16|WIPI3_CHICK WD repeat domain phosphoinositide-interacting
protein 3 OS=Gallus gallus GN=WDR45L PE=2 SV=1
Length = 344

Score = 57.4 bits (137), Expect = 5e-08
Identities = 34/111 (30%), Positives = 57/111 (51%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLNSTLSFIKGVLPKYFRSEWSYAQFKLSEEM 180
D GTV+IF A P RN S+L+ LPKYF S+WS+++F++
Sbjct: 250 DHGTVHIFAAE-------------DPKRNKQSSLASAS-FLPKYFSSKWSFSKFQVPSGS 295

Query: 181 KSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQKV 333
+ A G + +++ + DGS+YKF F+ + G+ + FL+ + K+
Sbjct: 296 PCICAFGTEPNAVLAICADGSYYKFLFNQK--GECSRDVYAQFLEMTDDKL 344


>sp|Q5R7W0|WIPI3_PONAB WD repeat domain phosphoinositide-interacting
protein 3 OS=Pongo abelii GN=WDR45L PE=2 SV=1
Length = 344

Score = 56.2 bits (134), Expect = 1e-07
Identities = 30/88 (34%), Positives = 47/88 (53%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLNSTLSFIKGVLPKYFRSEWSYAQFKLSEEM 180
D GTV+IF A P RN S+L+ LPKYF S+WS+++F++
Sbjct: 250 DHGTVHIFAAE-------------DPKRNKQSSLASAS-FLPKYFSSKWSFSKFQVPSGS 295

Query: 181 KSVIALGQDNHSIFVLGTDGSFYKFSFD 264
+ A G + +++ + DGS+YKF F+
Sbjct: 296 PCICAFGTEPNAVIAICADGSYYKFLFN 323


>sp|Q9CR39|WIPI3_MOUSE WD repeat domain phosphoinositide-interacting
protein 3 OS=Mus musculus GN=Wdr45l PE=2 SV=2
Length = 344

Score = 56.2 bits (134), Expect = 1e-07
Identities = 34/111 (30%), Positives = 56/111 (50%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLNSTLSFIKGVLPKYFRSEWSYAQFKLSEEM 180
D GTV+IF A P RN S+L+ LPKYF S+WS+++F++
Sbjct: 250 DHGTVHIFAAE-------------DPKRNKQSSLASAS-FLPKYFSSKWSFSKFQVPSGS 295

Query: 181 KSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQKV 333
+ A G + +++ + DGS+YKF F + G+ + FL+ + K+
Sbjct: 296 PCICAFGTEPNAVIAICADGSYYKFLFSPK--GECVRDVCAQFLEMTDDKL 344


>sp|Q5MNZ6|WIPI3_HUMAN WD repeat domain phosphoinositide-interacting
protein 3 OS=Homo sapiens GN=WDR45L PE=2 SV=2
Length = 344

Score = 56.2 bits (134), Expect = 1e-07
Identities = 30/88 (34%), Positives = 47/88 (53%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLNSTLSFIKGVLPKYFRSEWSYAQFKLSEEM 180
D GTV+IF A P RN S+L+ LPKYF S+WS+++F++
Sbjct: 250 DHGTVHIFAAE-------------DPKRNKQSSLASAS-FLPKYFSSKWSFSKFQVPSGS 295

Query: 181 KSVIALGQDNHSIFVLGTDGSFYKFSFD 264
+ A G + +++ + DGS+YKF F+
Sbjct: 296 PCICAFGTEPNAVIAICADGSYYKFLFN 323


>sp|Q54NA2|ATG18_DICDI Autophagy-related protein 18 OS=Dictyostelium
discoideum GN=atg18 PE=3 SV=1
Length = 372

Score = 50.1 bits (118), Expect = 9e-06
Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 12/116 (10%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGV---ASPNR-----NLNSTLSFIKGVLPKYFRSEWS-- 150
D GT++IF SNS+ H +SP+ N S + LP+ W
Sbjct: 243 DTGTIHIFKIDFSSSNSSSFHQAQPSSSPSGGMMGLNFGGLTSKMSSYLPEVISQVWEPS 302

Query: 151 --YAQFKLSEEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFL 312
+A K+ + S+ AL Q+N + VL D + +++FD GG++K + F+ L
Sbjct: 303 RDFAHIKIPPGIPSICALMQNNKTAMVLTADSLYMQYNFDESVGGELKLAKEFSLL 358


>sp|A1DE24|ATG18_NEOFI Autophagy-related protein 18 OS=Neosartorya
fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)
GN=atg18 PE=3 SV=1
Length = 429

Score = 42.0 bits (97), Expect = 0.002
Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 17/100 (17%)
Frame = +1

Query: 79 NRNLNSTLSF-IKGVLPKYFRSEWS----YAQFKLSEE------------MKSVIALGQD 207
++N+ ST++ + G LPK W +A FKL + ++SV+A+ +
Sbjct: 322 SQNVGSTVAAKVGGYLPKGVSEMWEPTRDFAWFKLPKPNQTSGGSVNNGPLRSVVAMSSN 381

Query: 208 NHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQ 327
+ V+ +DG+FY FS D GG+ + ++ L++ ++
Sbjct: 382 TPQVMVVTSDGNFYVFSIDLSKGGEGTLTKQYSVLESNDR 421


>sp|Q4WVD0|ATG18_ASPFU Autophagy-related protein 18 OS=Aspergillus
fumigatus GN=atg18 PE=3 SV=1
Length = 436

Score = 42.0 bits (97), Expect = 0.002
Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 17/100 (17%)
Frame = +1

Query: 79 NRNLNSTLSF-IKGVLPKYFRSEWS----YAQFKLSEE------------MKSVIALGQD 207
++N+ ST++ + G LPK W +A FKL + ++SV+A+ +
Sbjct: 329 SQNVGSTVAAKVGGYLPKGVSEMWEPTRDFAWFKLPKPSQTSGGSGNNGPLRSVVAMSSN 388

Query: 208 NHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQ 327
+ V+ +DG+FY FS D GG+ + ++ L++ ++
Sbjct: 389 TPQVMVVTSDGNFYVFSIDLSKGGEGTLTKQYSVLESNDR 428


tr_hit_id A7PTV3
Definition tr|A7PTV3|A7PTV3_VITVI Chromosome chr7 scaffold_31, whole genome shotgun sequence OS=Vitis vinifera
Align length 113
Score (bit) 104.0
E-value 4.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914330|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_F11.
(591 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PTV3|A7PTV3_VITVI Chromosome chr7 scaffold_31, whole genome... 104 4e-21
tr|A5AVB9|A5AVB9_VITVI Putative uncharacterized protein OS=Vitis... 104 4e-21
tr|B6SUF7|B6SUF7_MAIZE WD-repeat domain phosphoinositide-interac... 103 1e-20
tr|A7PS31|A7PS31_VITVI Chromosome chr14 scaffold_27, whole genom... 102 2e-20
tr|A5B8T7|A5B8T7_VITVI Putative uncharacterized protein OS=Vitis... 102 2e-20
tr|B4FQV7|B4FQV7_MAIZE Putative uncharacterized protein OS=Zea m... 101 3e-20
tr|A7PTV1|A7PTV1_VITVI Chromosome chr7 scaffold_31, whole genome... 101 3e-20
tr|Q8LR61|Q8LR61_ORYSJ cDNA clone:001-029-C10, full insert seque... 100 1e-19
tr|A2WYS0|A2WYS0_ORYSI Putative uncharacterized protein OS=Oryza... 100 1e-19
tr|B8LRE8|B8LRE8_PICSI Putative uncharacterized protein OS=Picea... 96 1e-18
tr|Q8GYD7|Q8GYD7_ARATH Putative uncharacterized protein At2g4081... 96 2e-18
tr|O22195|O22195_ARATH Putative uncharacterized protein At2g4081... 96 2e-18
tr|Q93VB2|Q93VB2_ARATH AT3g62770/F26K9_200 OS=Arabidopsis thalia... 94 4e-18
tr|Q0WPK3|Q0WPK3_ARATH Putative uncharacterized protein At3g5644... 94 4e-18
tr|Q5VQF8|Q5VQF8_ORYSJ cDNA clone:J023134M09, full insert sequen... 92 2e-17
tr|B8ADG4|B8ADG4_ORYSI Putative uncharacterized protein OS=Oryza... 92 2e-17
tr|A9NUD4|A9NUD4_PICSI Putative uncharacterized protein OS=Picea... 91 5e-17
tr|Q0DKE9|Q0DKE9_ORYSJ Os05g0169200 protein OS=Oryza sativa subs... 89 1e-16
tr|B8AYP2|B8AYP2_ORYSI Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|A3B0D3|A3B0D3_ORYSJ Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|A7Q3D3|A7Q3D3_VITVI Chromosome chr13 scaffold_48, whole genom... 88 3e-16
tr|Q9LZI8|Q9LZI8_ARATH Putative uncharacterized protein F26K9_20... 87 5e-16
tr|A2ZPP7|A2ZPP7_ORYSJ Putative uncharacterized protein OS=Oryza... 86 2e-15
tr|A9RSV2|A9RSV2_PHYPA Predicted protein OS=Physcomitrella paten... 83 1e-14
tr|A9S732|A9S732_PHYPA Predicted protein OS=Physcomitrella paten... 82 2e-14
tr|A9S1N3|A9S1N3_PHYPA Predicted protein OS=Physcomitrella paten... 80 9e-14
tr|Q9AS72|Q9AS72_ORYSJ P0028E10.20 protein OS=Oryza sativa subsp... 75 2e-12
tr|A9PBQ4|A9PBQ4_POPTR Putative uncharacterized protein OS=Popul... 66 2e-09
tr|Q8GSH9|Q8GSH9_ORYSJ Putative uncharacterized protein P0470D12... 64 6e-09
tr|B8B5U1|B8B5U1_ORYSI Putative uncharacterized protein OS=Oryza... 64 6e-09

>tr|A7PTV3|A7PTV3_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023544001
PE=4 SV=1
Length = 439

Score = 104 bits (259), Expect = 4e-21
Identities = 56/113 (49%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
Frame = +1

Query: 1 DKGTVYIFGART-IGSNSAD-THGVASPNRNLNST---LSFIKGVLPKYFRSEWSYAQFK 165
DKGTV++FG + GS D +HG + N + S+ LSFIKGVLPKYF SEWS AQF+
Sbjct: 325 DKGTVHVFGLKVNSGSLGNDKSHGASDANLAVASSGLSLSFIKGVLPKYFSSEWSVAQFR 384

Query: 166 LSEEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKARE 324
L E + ++A G +++ +LG DGSFY+ FD GG++ QLE NFLK E
Sbjct: 385 LHEGSQYIVAFGHQKNTVVILGMDGSFYRCQFDPVTGGEMTQLEYHNFLKPEE 437


>tr|A5AVB9|A5AVB9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032850 PE=4 SV=1
Length = 428

Score = 104 bits (259), Expect = 4e-21
Identities = 56/113 (49%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
Frame = +1

Query: 1 DKGTVYIFGART-IGSNSAD-THGVASPNRNLNST---LSFIKGVLPKYFRSEWSYAQFK 165
DKGTV++FG + GS D +HG + N + S+ LSFIKGVLPKYF SEWS AQF+
Sbjct: 314 DKGTVHVFGLKVNSGSLGNDKSHGASDANLAVASSGLSLSFIKGVLPKYFSSEWSVAQFR 373

Query: 166 LSEEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKARE 324
L E + ++A G +++ +LG DGSFY+ FD GG++ QLE NFLK E
Sbjct: 374 LHEGSQYIVAFGHQKNTVVILGMDGSFYRCQFDPVTGGEMTQLEYHNFLKPEE 426


>tr|B6SUF7|B6SUF7_MAIZE WD-repeat domain
phosphoinositide-interacting protein 3 OS=Zea mays PE=2
SV=1
Length = 443

Score = 103 bits (256), Expect = 1e-20
Identities = 48/112 (42%), Positives = 77/112 (68%), Gaps = 3/112 (2%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPN---RNLNSTLSFIKGVLPKYFRSEWSYAQFKLS 171
DKGT+++F + ++A+ + +P+ +++ LSFIKGVLPKYF SEWS AQF+L
Sbjct: 331 DKGTIHVFNLKINVGSTANDKPIPAPDPEVSHISPPLSFIKGVLPKYFHSEWSVAQFRLH 390

Query: 172 EEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQ 327
E + ++A G + +++ V+G DGSFY+ FD +GG++ QLE ++FLK +Q
Sbjct: 391 EGEQYIVAFGHEKNTVSVVGMDGSFYRCQFDPVNGGEMLQLECYSFLKPSDQ 442


>tr|A7PS31|A7PS31_VITVI Chromosome chr14 scaffold_27, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022737001
PE=4 SV=1
Length = 209

Score = 102 bits (253), Expect = 2e-20
Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 5/113 (4%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLN-----STLSFIKGVLPKYFRSEWSYAQFK 165
DKGTV++F + + +S NL+ S+LSF+KGVLP+YF SEWS AQF+
Sbjct: 95 DKGTVHVFSLKVESGSLGSDRSRSSSEPNLSVPSAVSSLSFMKGVLPRYFSSEWSVAQFR 154

Query: 166 LSEEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKARE 324
L E + ++A G +++ +LG DGSFY+ FD GG++ QLE +NFLK E
Sbjct: 155 LHEGSQYIVAFGHQKNTVVILGMDGSFYRCQFDPVAGGEMTQLEYYNFLKPEE 207


>tr|A5B8T7|A5B8T7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_044410 PE=4 SV=1
Length = 412

Score = 102 bits (253), Expect = 2e-20
Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 5/113 (4%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNLN-----STLSFIKGVLPKYFRSEWSYAQFK 165
DKGTV++F + + +S NL+ S+LSF+KGVLP+YF SEWS AQF+
Sbjct: 298 DKGTVHVFSLKVESGSLGSDRSRSSSEPNLSVPSAVSSLSFMKGVLPRYFSSEWSVAQFR 357

Query: 166 LSEEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKARE 324
L E + ++A G +++ +LG DGSFY+ FD GG++ QLE +NFLK E
Sbjct: 358 LHEGSQYIVAFGHQKNTVVILGMDGSFYRCQFDPVAGGEMTQLEYYNFLKPEE 410


>tr|B4FQV7|B4FQV7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 449

Score = 101 bits (252), Expect = 3e-20
Identities = 48/112 (42%), Positives = 76/112 (67%), Gaps = 3/112 (2%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNR---NLNSTLSFIKGVLPKYFRSEWSYAQFKLS 171
DKGT+++F + ++A+ + SP+ ++ +LSFIKGVLPKYF SEWS AQF+L
Sbjct: 337 DKGTIHVFNLKINVGSTANDKPMPSPDPEVPHIRPSLSFIKGVLPKYFHSEWSVAQFRLQ 396

Query: 172 EEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLKAREQ 327
E ++A G + +++ V+G DGSFY+ FD +GG++ QL+ ++FLK +Q
Sbjct: 397 EGEHYIVAFGHEKNTVAVVGMDGSFYRCRFDPVNGGEMLQLDCYSFLKPSDQ 448


>tr|A7PTV1|A7PTV1_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023542001
PE=4 SV=1
Length = 424

Score = 101 bits (252), Expect = 3e-20
Identities = 51/110 (46%), Positives = 71/110 (64%), Gaps = 5/110 (4%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRNL-----NSTLSFIKGVLPKYFRSEWSYAQFK 165
DKGTV++F + ++ + + N NL S+LSFIKGVLPKYF SEWS AQF+
Sbjct: 310 DKGTVHVFSLKVNLASPGNDKSRGASNSNLAVASSTSSLSFIKGVLPKYFSSEWSVAQFR 369

Query: 166 LSEEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLK 315
L E + ++A G +++ +LG DGSFY+ FD+ GG++ QLE NFLK
Sbjct: 370 LPEGSQYIVAFGHQKNTVVILGMDGSFYRCQFDAVSGGEMIQLEYHNFLK 419


>tr|Q8LR61|Q8LR61_ORYSJ cDNA clone:001-029-C10, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0423A12.30 PE=2 SV=1
Length = 457

Score = 99.8 bits (247), Expect = 1e-19
Identities = 47/108 (43%), Positives = 74/108 (68%), Gaps = 3/108 (2%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRN---LNSTLSFIKGVLPKYFRSEWSYAQFKLS 171
DKGT+++F + + + + +P+ + ++ +LSFIKGVLPKYF SEWS AQF+L
Sbjct: 343 DKGTIHVFNLKINVGLTTNDKPLPAPDPDVPHISPSLSFIKGVLPKYFHSEWSVAQFRLH 402

Query: 172 EEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLK 315
E + ++A G + +++ V+G DGSFY+ FD +GG++ QLE +NFLK
Sbjct: 403 EGEQYIVAFGHEKNTVAVVGMDGSFYRCQFDPVNGGEMLQLECYNFLK 450


>tr|A2WYS0|A2WYS0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05078 PE=4 SV=1
Length = 455

Score = 99.8 bits (247), Expect = 1e-19
Identities = 47/108 (43%), Positives = 74/108 (68%), Gaps = 3/108 (2%)
Frame = +1

Query: 1 DKGTVYIFGARTIGSNSADTHGVASPNRN---LNSTLSFIKGVLPKYFRSEWSYAQFKLS 171
DKGT+++F + + + + +P+ + ++ +LSFIKGVLPKYF SEWS AQF+L
Sbjct: 341 DKGTIHVFNLKINVGLTTNDKPLPAPDPDVPHISPSLSFIKGVLPKYFHSEWSVAQFRLH 400

Query: 172 EEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNFLK 315
E + ++A G + +++ V+G DGSFY+ FD +GG++ QLE +NFLK
Sbjct: 401 EGEQYIVAFGHEKNTVAVVGMDGSFYRCQFDPVNGGEMLQLECYNFLK 448


>tr|B8LRE8|B8LRE8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 403

Score = 96.3 bits (238), Expect = 1e-18
Identities = 50/125 (40%), Positives = 80/125 (64%), Gaps = 17/125 (13%)
Frame = +1

Query: 1 DKGTVYIFG---------ARTIGSNSA--DTHG------VASPNRNLNSTLSFIKGVLPK 129
DKGT++IFG +R++ + + T+G + SP N S+LSF++GVLP+
Sbjct: 275 DKGTIHIFGLNVPRTGEDSRSVDATQSLPGTNGSGGNLVIPSPGGNPGSSLSFMRGVLPR 334

Query: 130 YFRSEWSYAQFKLSEEMKSVIALGQDNHSIFVLGTDGSFYKFSFDSEHGGDVKQLESFNF 309
YF S+WS+AQF L E ++ ++A G ++I ++G DGSFY+ +FD +GG+++Q E F
Sbjct: 335 YFSSQWSFAQFHLPEGLQFLVAFGHQKNTIVIVGLDGSFYRCAFDPVNGGEMEQKEYARF 394

Query: 310 LKARE 324
LK+ E
Sbjct: 395 LKSDE 399