BP914334
Clone id YMU001_000057_G04
Library
Length 553
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_G04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTANGATCAAACCAAAAACTTGCGCAACACCTCAATTACAATTAATGAAATTGACAGGA
GCTGATCCAGCCATTTCTTTAATGGTGGAGGACCCAGCAGACATGCATTGAAAGCATGTA
AAAAGCCACTCCTGACAGAAAGAATCAAGAATCCTCCTAAACCCTAGTACCCAAATAGAA
AGTGAAATGTTTGCGACCTCTCAATACATACATAAGTGCGGTGCAGGGATGGCTGGATAC
TCTACAAGAATAAATTGAATACAGAGAATCTCGGGTAAAGATGGCGACGACTAAAGGCTG
CTAAACTAGGCTTTATGTACTCATCCCGCATCTGCACTTAGATCACTTGGCCTGTGCAGA
AATCTGGACAACTCAACACGATATGTACACTTGCCTGCAGCCCTACCGGCAACACTTCAG
AGAGGGGAAAGACTACTCGTACACAGGCTGAGGCAGGTCATCAGATACCGTGCCGATTGA
AATCGGCCAATACCTGTTCGGCCATTGCCCACATAATCTTCATTGCGCCCCTATTGCTGC
TGCAGTCCGCTGC
■■Homology search results ■■ -
sp_hit_id Q4QQW8
Definition sp|Q4QQW8|PLBL2_RAT Putative phospholipase B-like 2 OS=Rattus norvegicus
Align length 84
Score (bit) 34.7
E-value 0.32
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914334|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_G04.
(553 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4QQW8|PLBL2_RAT Putative phospholipase B-like 2 OS=Rattus no... 35 0.32
sp|Q3TCN2|PLBL2_MOUSE Putative phospholipase B-like 2 OS=Mus mus... 33 0.71
sp|P0C568|L_MOKV Large structural protein OS=Mokola virus GN=L P... 32 2.7

>sp|Q4QQW8|PLBL2_RAT Putative phospholipase B-like 2 OS=Rattus
norvegicus GN=RDCR-0918-3 PE=1 SV=2
Length = 585

Score = 34.7 bits (78), Expect = 0.32
Identities = 22/84 (26%), Positives = 38/84 (45%)
Frame = +2

Query: 191 LRPLNTYISAVQGWLDTLQE*IEYRESRVKMATTKGC*TRLYVLIPHLHLDHLACAEIWT 370
++PL + + G L+ L+ + ++ K + G + L L+P H D L W
Sbjct: 205 IKPLGFLLLQISGDLEDLEPALN--KTNTKPSVGSGSCSALIKLLPGSH-DLLVAHNTWN 261

Query: 371 TQHDMYTCLQPYRQHFREGKDYSY 442
+ +M ++ YR FREG Y
Sbjct: 262 SYQNMLRIIKKYRLQFREGPQEEY 285


>sp|Q3TCN2|PLBL2_MOUSE Putative phospholipase B-like 2 OS=Mus
musculus PE=1 SV=2
Length = 594

Score = 33.5 bits (75), Expect = 0.71
Identities = 22/84 (26%), Positives = 38/84 (45%)
Frame = +2

Query: 191 LRPLNTYISAVQGWLDTLQE*IEYRESRVKMATTKGC*TRLYVLIPHLHLDHLACAEIWT 370
++PL + + G L+ L+ + ++ K + G + L L+P H D L W
Sbjct: 214 IKPLGFLLLQISGDLEDLEPALN--KTNTKPSLGSGSCSALIKLLPGGH-DLLVAHNTWN 270

Query: 371 TQHDMYTCLQPYRQHFREGKDYSY 442
+ +M ++ YR FREG Y
Sbjct: 271 SYQNMLRIIKKYRLQFREGPQEEY 294


>sp|P0C568|L_MOKV Large structural protein OS=Mokola virus GN=L PE=3
SV=1
Length = 2127

Score = 31.6 bits (70), Expect = 2.7
Identities = 13/29 (44%), Positives = 20/29 (68%)
Frame = +1

Query: 391 LPAALPATLQRGERLLVHRLRQVIRYRAD 477
+PAA P T++ G R ++ L+QV+RY D
Sbjct: 1487 VPAAYPTTMEEGNRSVLCYLQQVLRYERD 1515


tr_hit_id A3IEN3
Definition tr|A3IEN3|A3IEN3_9BACI Putative uncharacterized protein OS=Bacillus sp. B14905
Align length 44
Score (bit) 33.9
E-value 6.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914334|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_G04.
(553 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A3IEN3|A3IEN3_9BACI Putative uncharacterized protein OS=Bacil... 34 6.0
tr|Q6RCF3|Q6RCF3_9CAUD Putative uncharacterized protein OS=Vibri... 33 10.0

>tr|A3IEN3|A3IEN3_9BACI Putative uncharacterized protein OS=Bacillus
sp. B14905 GN=BB14905_11105 PE=4 SV=1
Length = 286

Score = 33.9 bits (76), Expect = 6.0
Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 6/44 (13%)
Frame = +2

Query: 314 YVLIPHLHLDHLACAEIWT-----TQHDMYT-CLQPYRQHFREG 427
YV+ HLHLDH C E++T Q D + LQ Y ++ ++G
Sbjct: 116 YVVASHLHLDHAGCLELFTNATIIVQEDEFNGTLQTYARNVKDG 159


>tr|Q6RCF3|Q6RCF3_9CAUD Putative uncharacterized protein OS=Vibrio
phage VP2 PE=4 SV=1
Length = 594

Score = 33.1 bits (74), Expect = 10.0
Identities = 20/63 (31%), Positives = 34/63 (53%)
Frame = -3

Query: 248 LVEYPAIPAPHLCMY*EVANISLSIWVLGFRRILDSFCQEWLFTCFQCMSAGSSTIKEMA 69
L PA+ AP + EV N ++++WV R+++ + EW T + +A TI + A
Sbjct: 64 LFRLPAVDAPSNDVIVEVGNTNIAVWVNDVRQVVANTPSEWRNTIDRIQTA-YDTIGDDA 122

Query: 68 GSA 60
G+A
Sbjct: 123 GAA 125