BP914338
Clone id YMU001_000057_G09
Library
Length 570
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000057_G09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACAGGGAACGTGGCCCTGGAACGCTGTTCTTGAATAGGAAACCTGTTCCCCTTGCTCCC
TCTCTCTGGGAAGTCCCTATTTTCTTGGTCCAGACAGCTTTGTTTCTTAACCTGTTGGTG
GACAAGGCTGCCTCGCCTTATGGTAAGTAAACTGTGTGTGTGTTGGTAAGGACATCCGCT
ACCACAACTCTTTCTGCCCGGTTTCCTACTCAGTTCCCACCTTTGCTAGCAGACACTAGA
CAAACGGGTTTCCTCTAGGTCTTTTGGCTTTCCTTTCTTCGCCTTTGGGTTCGGTTGATG
ACCCTCTTTTAGAACTTTGCAGCTGATTCCCTTTTGGCATGTTGCCTTTGCCTCACCTGT
TTTGTCCTCCCTTCTCCTCTGGCAGTCCTTTAGCAGCTTCTGGGAGCATGGGCTGAGCTG
TTATGGGAGTTCCTTCTATGTGTCTAGATTGGTGAGTCCTGGTCATCTCTACTTTTGTCG
GGCATCGATTGCAGTTTACATGGTTTGCTAGTTGTTCACTCCTCCCACTGTCATCTTCTA
TAGTCCAAGGAGGCTTTGTGGTTTACCTTC
■■Homology search results ■■ -
sp_hit_id P05006
Definition sp|P05006|IFNA4_HORSE Interferon alpha-4 OS=Equus caballus
Align length 53
Score (bit) 33.9
E-value 0.59
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914338|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_G09.
(570 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P05006|IFNA4_HORSE Interferon alpha-4 OS=Equus caballus PE=3 ... 34 0.59
sp|P05005|IFNA3_HORSE Interferon alpha-3 OS=Equus caballus PE=3 ... 34 0.59
sp|P05004|IFNA2_HORSE Interferon alpha-2 OS=Equus caballus PE=3 ... 34 0.59
sp|P01570|IFN14_HUMAN Interferon alpha-14 OS=Homo sapiens GN=IFN... 33 0.77
sp|Q9NS56|TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo... 33 0.99
sp|P01562|IFNA1_HUMAN Interferon alpha-1/13 OS=Homo sapiens GN=I... 33 1.0
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN... 33 1.3
sp|P05003|IFNA1_HORSE Interferon alpha-1 OS=Equus caballus PE=3 ... 32 1.7
sp|Q8BI21|RNF38_MOUSE RING finger protein 38 OS=Mus musculus GN=... 32 2.9
sp|Q9H0F5|RNF38_HUMAN RING finger protein 38 OS=Homo sapiens GN=... 32 2.9
sp|P49877|IFNAG_BOVIN Interferon alpha-G OS=Bos taurus GN=IFNAG ... 32 2.9
sp|A7HH11|NHAA_ANADF Na(+)/H(+) antiporter nhaA OS=Anaeromyxobac... 31 4.9
sp|P49878|IFNAH_BOVIN Interferon alpha-H OS=Bos taurus GN=IFNAH ... 31 5.0
sp|P05008|IFNAB_BOVIN Interferon alpha-B OS=Bos taurus GN=IFNAB ... 31 5.0
sp|Q01RU9|FPG_SOLUE Formamidopyrimidine-DNA glycosylase OS=Solib... 31 5.0
sp|Q7Z460|CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens... 30 6.4
sp|Q1QH69|ENGB_NITHX Probable GTP-binding protein engB OS=Nitrob... 30 6.5
sp|Q7T3T9|ZAR1_FUGRU Zygote arrest protein 1 OS=Fugu rubripes GN... 30 8.4
sp|Q8NFC6|FA44A_HUMAN Protein FAM44A OS=Homo sapiens GN=FAM44A P... 30 8.4
sp|P05009|IFNAC_BOVIN Interferon alpha-C OS=Bos taurus GN=IFNAC ... 30 8.5

>sp|P05006|IFNA4_HORSE Interferon alpha-4 OS=Equus caballus PE=3
SV=1
Length = 184

Score = 33.9 bits (76), Expect = 0.59
Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
Frame = -1

Query: 189 SCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRF 40
SC GC HTHSL R L+ Q ++ SCL D+ + FP+ GN+F
Sbjct: 19 SCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQF 71


>sp|P05005|IFNA3_HORSE Interferon alpha-3 OS=Equus caballus PE=3
SV=1
Length = 184

Score = 33.9 bits (76), Expect = 0.59
Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
Frame = -1

Query: 189 SCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRF 40
SC GC HTHSL R L+ Q ++ SCL D+ + FP+ GN+F
Sbjct: 19 SCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQF 71


>sp|P05004|IFNA2_HORSE Interferon alpha-2 OS=Equus caballus PE=3
SV=1
Length = 184

Score = 33.9 bits (76), Expect = 0.59
Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
Frame = -1

Query: 189 SCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRF 40
SC GC HTHSL R L+ Q ++ SCL D+ + FP+ GN+F
Sbjct: 19 SCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQF 71


>sp|P01570|IFN14_HUMAN Interferon alpha-14 OS=Homo sapiens GN=IFNA14
PE=1 SV=3
Length = 189

Score = 33.5 bits (75), Expect = 0.77
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRF 40
+ SC GC THSL R L+ Q ++ SCL D+ + +FP+ GN+F
Sbjct: 17 KSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQF 71


>sp|Q9NS56|TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo
sapiens GN=TOPORS PE=1 SV=1
Length = 1045

Score = 33.1 bits (74), Expect = 0.99
Identities = 21/66 (31%), Positives = 29/66 (43%)
Frame = -3

Query: 460 RTHQSRHIEGTPITAQPMLPEAAKGLPEEKGGQNR*GKGNMPKGNQLQSSKRGSSTEPKG 281
R +++RH+EGT AQP A+K + GN + S R S E K
Sbjct: 796 RKYKTRHLEGTNEVAQPSREFASKAKDSHYQKSSSKLDGNYKNESDTFSDSRSSDRETKH 855

Query: 280 EERKAK 263
+ RK K
Sbjct: 856 KRRKRK 861


>sp|P01562|IFNA1_HUMAN Interferon alpha-1/13 OS=Homo sapiens
GN=IFNA1 PE=1 SV=1
Length = 189

Score = 33.1 bits (74), Expect = 1.0
Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRF 40
+ SC GC THSL R L+ Q ++ SCL D+ + FP+ GN+F
Sbjct: 17 KSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQF 71


>sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens
GN=ZNF311 PE=1 SV=2
Length = 666

Score = 32.7 bits (73), Expect = 1.3
Identities = 14/33 (42%), Positives = 21/33 (63%)
Frame = -1

Query: 381 QRRREDKTGEAKATCQKGISCKVLKEGHQPNPK 283
++ RE+K G + TC+KG + KVL + PN K
Sbjct: 201 EKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSK 233


>sp|P05003|IFNA1_HORSE Interferon alpha-1 OS=Equus caballus PE=3
SV=1
Length = 184

Score = 32.3 bits (72), Expect = 1.7
Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%)
Frame = -1

Query: 186 CGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRF 40
C GC HTHSL R L+ Q ++ SCL D+ + FP+ GN+F
Sbjct: 20 CSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQF 71


>sp|Q8BI21|RNF38_MOUSE RING finger protein 38 OS=Mus musculus
GN=Rnf38 PE=2 SV=1
Length = 518

Score = 31.6 bits (70), Expect = 2.9
Identities = 30/98 (30%), Positives = 38/98 (38%), Gaps = 18/98 (18%)
Frame = +3

Query: 150 NCVCVGKDIRYHNSFCPVSYSVPTFASRH*TNGFPL---------------GLLAFLSS- 281
N V V + H PVSY+V T A +G PL G S
Sbjct: 184 NAVMVDIHDQLHQGTVPVSYTVTTVA----PHGLPLCTGQHIPACSTQQVPGCSVVFSGQ 239

Query: 282 --PLGSVDDPLLELCS*FPFGMLPLPHLFCPPFSSGSP 389
P+ SV P+L+ CS LP+P+ PP S P
Sbjct: 240 HLPVCSVPPPMLQACS---VQHLPVPYAAFPPLISSDP 274


>sp|Q9H0F5|RNF38_HUMAN RING finger protein 38 OS=Homo sapiens
GN=RNF38 PE=1 SV=4
Length = 515

Score = 31.6 bits (70), Expect = 2.9
Identities = 30/98 (30%), Positives = 38/98 (38%), Gaps = 18/98 (18%)
Frame = +3

Query: 150 NCVCVGKDIRYHNSFCPVSYSVPTFASRH*TNGFPL---------------GLLAFLSS- 281
N V V + H PVSY+V T A +G PL G S
Sbjct: 181 NAVMVDIHDQLHQGTVPVSYTVTTVA----PHGIPLCTGQHIPACSTQQVPGCSVVFSGQ 236

Query: 282 --PLGSVDDPLLELCS*FPFGMLPLPHLFCPPFSSGSP 389
P+ SV P+L+ CS LP+P+ PP S P
Sbjct: 237 HLPVCSVPPPMLQACS---VQHLPVPYAAFPPLISSDP 271


tr_hit_id A5K4S8
Definition tr|A5K4S8|A5K4S8_PLAVI Putative uncharacterized protein OS=Plasmodium vivax
Align length 137
Score (bit) 39.7
E-value 0.12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914338|Adiantum capillus-veneris mRNA, clone:
YMU001_000057_G09.
(570 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5K4S8|A5K4S8_PLAVI Putative uncharacterized protein OS=Plasm... 40 0.12
tr|B7G0I2|B7G0I2_PHATR Predicted protein OS=Phaeodactylum tricor... 36 1.3
tr|Q95J78|Q95J78_SAGOE Interferon-alpha OS=Saguinus oedipus GN=i... 36 1.7
tr|Q1PCX2|Q1PCX2_CERAE Interferon alpha (Fragment) OS=Cercopithe... 35 3.0
tr|Q293H8|Q293H8_DROPS GA12417 OS=Drosophila pseudoobscura pseud... 35 3.8
tr|B6KBH5|B6KBH5_TOXGO Zinc finger (C2H2 type) protein, putative... 34 5.0
tr|B6CK04|B6CK04_MACMU Interferon alpha 1 OS=Macaca mulatta PE=4... 34 5.0
tr|Q7MRN8|Q7MRN8_WOLSU Putative uncharacterized protein OS=Wolin... 34 6.5
tr|A6GH03|A6GH03_9DELT ErfK/YbiS/YcfS/YnhG family protein OS=Ple... 34 6.5
tr|B6CK09|B6CK09_CERTO Interferon alpha 1 OS=Cercocebus torquatu... 34 6.6
tr|B6CK05|B6CK05_CERTO Interferon alpha 1 OS=Cercocebus torquatu... 34 6.6
tr|B6A1C4|B6A1C4_RHILW ATP dependent DNA ligase OS=Rhizobium leg... 26 7.3
tr|Q034A9|Q034A9_LACC3 Permease of the major facilitator superfa... 33 8.6
tr|B3WBB4|B3WBB4_LACCB Permease of the major facilitator superfa... 33 8.6
tr|B6CK06|B6CK06_CERTO Interferon alpha 1 OS=Cercocebus torquatu... 33 8.6
tr|B6MMT0|B6MMT0_BRAFL Putative uncharacterized protein OS=Branc... 33 8.6

>tr|A5K4S8|A5K4S8_PLAVI Putative uncharacterized protein OS=Plasmodium
vivax GN=PVX_091955 PE=4 SV=1
Length = 1057

Score = 39.7 bits (91), Expect = 0.12
Identities = 36/137 (26%), Positives = 60/137 (43%), Gaps = 8/137 (5%)
Frame = -1

Query: 402 QKLLKDCQRRREDKTGEAKATCQKGISCKVLKEGHQPNP--KAKKGKPKDLEETRLSSVC 229
+K K + R+ K ++K KG K K + + K+KK K K ++T+ + V
Sbjct: 881 RKEAKKKSKERKSKGEKSKREKSKGEKSKREKSKGEKSKREKSKKEKSKKTKKTKPTKVK 940

Query: 228 *QRWELSRKPGRKSCGSGCPYQHTHSLLTIRRGSLVHQQVK------KQSCLDQENRDFP 67
++ + ++ K G PY H HS R S V V+ + S +D+ + F
Sbjct: 941 PKKVKPTKMKSPKKTHDGTPYSHRHS---SRSRSSVGSSVESSRSHSESSSMDKSMKHFS 997

Query: 66 ERGSKGNRFPIQEQRSR 16
+GSKG +R R
Sbjct: 998 AKGSKGKAHKRDARRRR 1014


>tr|B7G0I2|B7G0I2_PHATR Predicted protein OS=Phaeodactylum
tricornutum CCAP 1055/1 GN=PHATRDRAFT_36143 PE=4 SV=1
Length = 180

Score = 36.2 bits (82), Expect = 1.3
Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 3/86 (3%)
Frame = -2

Query: 515 TTSKPCKLQSMPDKSRDDQDSPI*THRRNSHNSSAHAPRSC*--RTARGEGRTKQVRQR- 345
++S + Q +P++ D+ H + S S SC R R G+ K+ R R
Sbjct: 6 SSSASARKQEIPEEQPRRNDTTAARHSKRSSRESDDELSSCADHRRTRNHGKKKKSRHRS 65

Query: 344 QHAKRESAAKF*KRVINRTQRRRKES 267
QH+ E K ++ + R +RRR+E+
Sbjct: 66 QHSSDEDQKKSSRKGVGRRRRRRREA 91


>tr|Q95J78|Q95J78_SAGOE Interferon-alpha OS=Saguinus oedipus
GN=ifn-alpha PE=3 SV=1
Length = 189

Score = 35.8 bits (81), Expect = 1.7
Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRFPIQEQ 25
+ SC GC THSL R L+ Q ++ SCL D+ + +FP+ GN+F Q
Sbjct: 17 KSSCSLGCDLPQTHSLGNRRTLMLLAQMRRISPFSCLKDRRDFEFPQEEFDGNQF----Q 72

Query: 24 RSRATF 7
++RA F
Sbjct: 73 KARAIF 78


>tr|Q1PCX2|Q1PCX2_CERAE Interferon alpha (Fragment) OS=Cercopithecus
aethiops PE=2 SV=1
Length = 74

Score = 35.0 bits (79), Expect = 3.0
Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCLDQENR--DFPERGSKGNRF 40
+ C GC THSL R L+ Q ++ SC D +N DFP++ GN+F
Sbjct: 17 KSGCSLGCDLPETHSLDNRRTMMLLKQMSRISPSSCSDGQNMTLDFPQQEFDGNQF 72


>tr|Q293H8|Q293H8_DROPS GA12417 OS=Drosophila pseudoobscura
pseudoobscura GN=GA12417 PE=4 SV=2
Length = 579

Score = 34.7 bits (78), Expect = 3.8
Identities = 24/78 (30%), Positives = 39/78 (50%)
Frame = -2

Query: 491 QSMPDKSRDDQDSPI*THRRNSHNSSAHAPRSC*RTARGEGRTKQVRQRQHAKRESAAKF 312
QS P + RD SP RR SHNS+ PR R++ + + + R+ + +S +
Sbjct: 232 QSPPRRRRDSDQSP--PRRRRSHNSNQSPPRKGRRSSADQSPPR--KGRRSSPDQSPPRR 287

Query: 311 *KRVINRTQRRRKESQKT 258
+ V RRRK+S ++
Sbjct: 288 RRDVDQSPDRRRKDSDQS 305


>tr|B6KBH5|B6KBH5_TOXGO Zinc finger (C2H2 type) protein, putative
OS=Toxoplasma gondii ME49 GN=TGME49_059650 PE=4 SV=1
Length = 397

Score = 34.3 bits (77), Expect = 5.0
Identities = 21/106 (19%), Positives = 43/106 (40%), Gaps = 8/106 (7%)
Frame = -3

Query: 535 DDSGRSEQLANHVNCNRCPTKVEMTRTHQSRHIEGTPITAQPMLPEAAKGLPEEKGGQNR 356
++ + + H C CP K+ + RH++ + E G+P+E+ +++
Sbjct: 203 EEESQEQNFRGHFQCKLCPKKIFIFEADLERHLQSKKHLRREAEWEKEHGVPQEQEEESK 262

Query: 355 -------*GKGNMPKG-NQLQSSKRGSSTEPKGEERKAKRPRGNPF 242
K KG ++ S G S + ++K R +G+ F
Sbjct: 263 ERASASSSTKERRKKGIKSVEESDSGPSPSSRRSQKKGSRSQGDEF 308


>tr|B6CK04|B6CK04_MACMU Interferon alpha 1 OS=Macaca mulatta PE=4
SV=1
Length = 189

Score = 34.3 bits (77), Expect = 5.0
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRF 40
+ SC GC THSL R L+ Q ++ SCL D+ + FP++ GN+F
Sbjct: 17 KSSCSLGCDLPETHSLDNRRTMMLLKQMSRISPSSCLMDRHDFGFPQQEFDGNQF 71


>tr|Q7MRN8|Q7MRN8_WOLSU Putative uncharacterized protein
OS=Wolinella succinogenes GN=WS1163 PE=4 SV=1
Length = 100

Score = 33.9 bits (76), Expect = 6.5
Identities = 16/39 (41%), Positives = 22/39 (56%)
Frame = +3

Query: 330 PFGMLPLPHLFCPPFSSGSPLAASGSMG*AVMGVPSMCL 446
P GM P+PHL P G+P GS+ A+MG +C+
Sbjct: 18 PTGMNPIPHLGGPILGPGAPTVLIGSLPAALMGDDCVCV 56


>tr|A6GH03|A6GH03_9DELT ErfK/YbiS/YcfS/YnhG family protein
OS=Plesiocystis pacifica SIR-1 GN=PPSIR1_31038 PE=4 SV=1
Length = 619

Score = 33.9 bits (76), Expect = 6.5
Identities = 25/82 (30%), Positives = 30/82 (36%), Gaps = 1/82 (1%)
Frame = -3

Query: 487 RCPTKVEMTRTHQSRHIEGTPITAQPMLPEAAKGLPEEKGGQNR*GKGNMPKGNQLQSSK 308
R PTK E T + R I + T +P+ E P E GG G G
Sbjct: 210 RAPTKEEYVETQERRAILESERTGEPLPGEEPAPSPGEGGGDGGAAAGGDGGGEAAAGDG 269

Query: 307 RGSS-TEPKGEERKAKRPRGNP 245
G + P GEE A P P
Sbjct: 270 GGEALPAPDGEEAPAPEPAPEP 291


>tr|B6CK09|B6CK09_CERTO Interferon alpha 1 OS=Cercocebus torquatus
atys PE=4 SV=1
Length = 189

Score = 33.9 bits (76), Expect = 6.6
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
Frame = -1

Query: 195 RKSCGSGCPYQHTHSLLTIRRGSLVHQ--QVKKQSCL-DQENRDFPERGSKGNRF 40
+ SC GC THSL R L+ Q ++ SCL D+ + FP++ GN+F
Sbjct: 17 KSSCSLGCDLPETHSLDNRRTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQF 71