BP914353
Clone id YMU001_000058_A01
Library
Length 555
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000058_A01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGCTGCTGAAGGCAAGCTAGTTGGCATGTTCGAGATGACATACAGATGCTCTGCAGAGAG
GCCAATGAGAAGTCAGAATTTTGCAGTACTTGATGCTGATGAAGAAGCACTTGCCCTCAC
AAGAGTGCTAGCAACCAGAGTACTAAGCCAAATTAATGTCTTTTTGGTGATGGCCACAAT
ACCAGTTTATACAGGAGCTATCAATGATGACGTCTTGAACGTACACTTGAAGTTCAGTGG
GGAGACTTTAGTAGATTCTAGTCTGTGCTTGATAACTATCACATTGGAGCTTCAAAGCAT
GGGCGATAGCACCGACGCTTTACCTGTATTAGTGAAAGTTAACTGTGAAGATTCTGTATT
TGGCTTGAATCTTCTCAACCGTCTTCAGAAGGTGATTACCGAGAAGCAGTAGCCGGTATG
CAATGGTCTTCTGAATCAAGAAGTTTTGTAGGTTCATCTCTTGCTAAAGCTTAAACATGA
TGTACATTATACCCTATCCGTGACTGCTCTGCCTTTTTCTGTCCCTGCCTTTAATTGTAT
GAGGTTATATCTGTA
■■Homology search results ■■ -
sp_hit_id P57557
Definition sp|P57557|FOLD_BUCAI Bifunctional protein folD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum
Align length 90
Score (bit) 32.0
E-value 2.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914353|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_A01.
(555 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P57557|FOLD_BUCAI Bifunctional protein folD OS=Buchnera aphid... 32 2.1

>sp|P57557|FOLD_BUCAI Bifunctional protein folD OS=Buchnera
aphidicola subsp. Acyrthosiphon pisum GN=folD PE=3 SV=1
Length = 285

Score = 32.0 bits (71), Expect = 2.1
Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 4/90 (4%)
Frame = -1

Query: 408 CFSVITF*RRLRRFKPNTESSQLTFTNTGKASVLSPML*SSNVIVIK---HRLESTK-VS 241
C + +T R + K + +++ L GKA+ L + IVI +RL++ K V
Sbjct: 184 CTTTVTH-RFTKNLKDHVQNADLLIVAVGKANFLKGSWIKTGSIVIDVGINRLKNGKVVG 242

Query: 240 PLNFKCTFKTSSLIAPV*TGIVAITKKTLI 151
+ FK + +S I PV G+ +T TL+
Sbjct: 243 DVEFKTAYLRASYITPVPGGVGPMTVATLL 272


tr_hit_id A7PIU1
Definition tr|A7PIU1|A7PIU1_VITVI Chromosome chr13 scaffold_17, whole genome shotgun sequence OS=Vitis vinifera
Align length 135
Score (bit) 84.0
E-value 5.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP914353|Adiantum capillus-veneris mRNA, clone:
YMU001_000058_A01.
(555 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PIU1|A7PIU1_VITVI Chromosome chr13 scaffold_17, whole genom... 84 5e-15
tr|Q93YS9|Q93YS9_ARATH Putative AP3-complex beta-3A adaptin subu... 72 2e-11
tr|Q9M2T1|Q9M2T1_ARATH Adaptor protein/ adaptin-like (Fragment) ... 64 5e-09
tr|Q5JM89|Q5JM89_ORYSJ Putative adaptor-related protein complex ... 64 5e-09
tr|Q0JFL8|Q0JFL8_ORYSJ Os01g0973300 protein (Fragment) OS=Oryza ... 64 5e-09
tr|A2WZL8|A2WZL8_ORYSI Putative uncharacterized protein OS=Oryza... 64 5e-09
tr|B7PMX4|B7PMX4_IXOSC AP-3 complex subunit beta-1, putative OS=... 37 0.70
tr|A9JRG4|A9JRG4_DANRE LOC563316 protein (Fragment) OS=Danio rer... 35 2.0
tr|Q5CXM3|Q5CXM3_CRYPV Zinc ZIP transporter protein, putative OS... 35 2.0
tr|Q7TQY2|Q7TQY2_MOUSE Olfactory receptor 1286 OS=Mus musculus G... 34 4.6
tr|B4JKC1|B4JKC1_DROGR GH12632 OS=Drosophila grimshawi GN=GH1263... 33 7.8

>tr|A7PIU1|A7PIU1_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018474001
PE=4 SV=1
Length = 1118

Score = 84.0 bits (206), Expect = 5e-15
Identities = 54/135 (40%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
Frame = +2

Query: 8 EGKLVGMFEMTYRCSAE---RPMRSQNFAVXXXXXXXXXXTRVLATRVLSQINVFLVMAT 178
E L GMFE RC+ R M S + LA ++LS N+FLV
Sbjct: 984 ESHLPGMFEYERRCTFTDHIREMNSDKGDSSLTKDKFLVICKSLAVKMLSNANLFLVSVD 1043

Query: 179 IPVYTGAINDDVLNVHLKFSGETLVDSSLCLITITLELQSMGDSTDALPVLVKVNCEDSV 358
+PV + DD + L+FS E L +S CLITIT+E G+ ++ L V +KVNCE++V
Sbjct: 1044 MPVASNL--DDASGLRLRFSSEILSNSIPCLITITIE----GNCSEPLNVTIKVNCEETV 1097

Query: 359 FGLNLLNRLQKVITE 403
FGLNLLNR+ + E
Sbjct: 1098 FGLNLLNRIVNFLVE 1112


>tr|Q93YS9|Q93YS9_ARATH Putative AP3-complex beta-3A adaptin subunit
OS=Arabidopsis thaliana GN=At3g55480 PE=2 SV=1
Length = 987

Score = 72.0 bits (175), Expect = 2e-11
Identities = 46/134 (34%), Positives = 68/134 (50%)
Frame = +2

Query: 2 AAEGKLVGMFEMTYRCSAERPMRSQNFAVXXXXXXXXXXTRVLATRVLSQINVFLVMATI 181
A E +L GMFE + RC+ + ++ + +VLS N+ LV +
Sbjct: 856 ATESRLPGMFEYSRRCTFDDHVKDSR--TENGKDKFLSICESITLKVLSNSNLHLVSVDL 913

Query: 182 PVYTGAINDDVLNVHLKFSGETLVDSSLCLITITLELQSMGDSTDALPVLVKVNCEDSVF 361
PV +D + L+FS + L LITIT+E G T+ L + VK+NCE++VF
Sbjct: 914 PVANSL--EDATGLRLRFSSKILSSEIPLLITITVE----GKCTEVLNLTVKINCEETVF 967

Query: 362 GLNLLNRLQKVITE 403
GLNLLNR+ + E
Sbjct: 968 GLNLLNRIANFMVE 981


>tr|Q9M2T1|Q9M2T1_ARATH Adaptor protein/ adaptin-like (Fragment)
OS=Arabidopsis thaliana GN=T22E16.140 PE=4 SV=1
Length = 1123

Score = 63.9 bits (154), Expect = 5e-09
Identities = 37/92 (40%), Positives = 53/92 (57%)
Frame = +2

Query: 128 LATRVLSQINVFLVMATIPVYTGAINDDVLNVHLKFSGETLVDSSLCLITITLELQSMGD 307
+ +VLS N+ LV +PV +D + L+FS + L LITIT+E G
Sbjct: 1032 ITLKVLSNSNLHLVSVDLPVANSL--EDATGLRLRFSSKILSSEIPLLITITVE----GK 1085

Query: 308 STDALPVLVKVNCEDSVFGLNLLNRLQKVITE 403
T+ L + VK+NCE++VFGLNLLNR+ + E
Sbjct: 1086 CTEVLNLTVKINCEETVFGLNLLNRIANFMVE 1117


>tr|Q5JM89|Q5JM89_ORYSJ Putative adaptor-related protein complex AP-3,
beta 2 subunit (Putative uncharacterized protein)
OS=Oryza sativa subsp. japonica GN=P0698H10.15 PE=4 SV=1
Length = 1090

Score = 63.9 bits (154), Expect = 5e-09
Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 2/132 (1%)
Frame = +2

Query: 8 EGKLVGMFEMTYRCSAERPMRS--QNFAVXXXXXXXXXXTRVLATRVLSQINVFLVMATI 181
E +L GMFE RC+ + ++ N + LA+++LS N LV +
Sbjct: 964 ENQLRGMFEYARRCTFKDHLQKLEHNDDSEEHTDKNLLIAQSLASKILSNANFHLVSMDM 1023

Query: 182 PVYTGAINDDVLNVHLKFSGETLVDSSLCLITITLELQSMGDSTDALPVLVKVNCEDSVF 361
PV T +I +D + +FS E L S+ CLITI E G ++ L + KVN ED+ F
Sbjct: 1024 PV-TFSI-EDASGLCWRFSSEILSTSNPCLITILAE----GHISEPLDLTAKVNSEDTAF 1077

Query: 362 GLNLLNRLQKVI 397
GLNLLNR+ +I
Sbjct: 1078 GLNLLNRVVAII 1089


>tr|Q0JFL8|Q0JFL8_ORYSJ Os01g0973300 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os01g0973300 PE=4 SV=1
Length = 927

Score = 63.9 bits (154), Expect = 5e-09
Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 2/132 (1%)
Frame = +2

Query: 8 EGKLVGMFEMTYRCSAERPMRS--QNFAVXXXXXXXXXXTRVLATRVLSQINVFLVMATI 181
E +L GMFE RC+ + ++ N + LA+++LS N LV +
Sbjct: 801 ENQLRGMFEYARRCTFKDHLQKLEHNDDSEEHTDKNLLIAQSLASKILSNANFHLVSMDM 860

Query: 182 PVYTGAINDDVLNVHLKFSGETLVDSSLCLITITLELQSMGDSTDALPVLVKVNCEDSVF 361
PV T +I +D + +FS E L S+ CLITI E G ++ L + KVN ED+ F
Sbjct: 861 PV-TFSI-EDASGLCWRFSSEILSTSNPCLITILAE----GHISEPLDLTAKVNSEDTAF 914

Query: 362 GLNLLNRLQKVI 397
GLNLLNR+ +I
Sbjct: 915 GLNLLNRVVAII 926


>tr|A2WZL8|A2WZL8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05405 PE=4 SV=1
Length = 981

Score = 63.9 bits (154), Expect = 5e-09
Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 2/132 (1%)
Frame = +2

Query: 8 EGKLVGMFEMTYRCSAERPMRS--QNFAVXXXXXXXXXXTRVLATRVLSQINVFLVMATI 181
E +L GMFE RC+ + ++ N + LA+++LS N LV +
Sbjct: 855 ENQLRGMFEYARRCTFKDHLQKLEHNDDSEEHTDKNLLIAQSLASKILSNANFHLVSMDM 914

Query: 182 PVYTGAINDDVLNVHLKFSGETLVDSSLCLITITLELQSMGDSTDALPVLVKVNCEDSVF 361
PV T +I +D + +FS E L S+ CLITI E G ++ L + KVN ED+ F
Sbjct: 915 PV-TFSI-EDASGLCWRFSSEILSTSNPCLITILAE----GHISEPLDLTAKVNSEDTAF 968

Query: 362 GLNLLNRLQKVI 397
GLNLLNR+ +I
Sbjct: 969 GLNLLNRVVAII 980


>tr|B7PMX4|B7PMX4_IXOSC AP-3 complex subunit beta-1, putative
OS=Ixodes scapularis GN=IscW_ISCW005629 PE=4 SV=1
Length = 1040

Score = 37.0 bits (84), Expect = 0.70
Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
Frame = +2

Query: 173 ATIPVYTGA---INDDVLNVHLKFSGETLVDSSLCLITITLELQSMGDSTDALPVLVKVN 343
AT +Y A + D+ L+F+G+TL +SL L+TI L S A + VN
Sbjct: 969 ATKQIYAAANLLLLDEAEPGVLRFAGQTLASASLVLVTIQL-------SDGACKGSLTVN 1021

Query: 344 CEDSVFGLNLLNRLQKVIT 400
CE V G LL L++ ++
Sbjct: 1022 CEKMVIGSMLLKELKEALS 1040


>tr|A9JRG4|A9JRG4_DANRE LOC563316 protein (Fragment) OS=Danio rerio
GN=LOC563316 PE=2 SV=1
Length = 948

Score = 35.4 bits (80), Expect = 2.0
Identities = 37/130 (28%), Positives = 62/130 (47%)
Frame = +2

Query: 8 EGKLVGMFEMTYRCSAERPMRSQNFAVXXXXXXXXXXTRVLATRVLSQINVFLVMATIPV 187
+GKL+GM E SA M +N + ++ ++ +V+S N+
Sbjct: 850 QGKLLGMNES----SATITMSPENIS-----------SQSVSRKVVSVANL--------- 885

Query: 188 YTGAINDDVLNVHLKFSGETLVDSSLCLITITLELQSMGDSTDALPVLVKVNCEDSVFGL 367
G I+ N+H +F+G+T+ SSL L+++TL+ DA + VN E SV G
Sbjct: 886 --GVISSTQENIH-RFAGKTVSSSSLVLVSVTLK------DPDA---QITVNTEKSVMGS 933

Query: 368 NLLNRLQKVI 397
LL +L+ +
Sbjct: 934 MLLRQLKTAL 943


>tr|Q5CXM3|Q5CXM3_CRYPV Zinc ZIP transporter protein, putative
OS=Cryptosporidium parvum Iowa II GN=cgd6_490 PE=4 SV=1
Length = 437

Score = 35.4 bits (80), Expect = 2.0
Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 5/101 (4%)
Frame = +2

Query: 122 RVLATRVLSQINVFLVMAT---IPVYTGAINDDVLNVHLKFSGETLVDSSLC-LITITLE 289
+++ +++LS I+V V IP+Y G +N +L F+G TL+ SLC LI E
Sbjct: 3 KLILSKILSFISVIFVGGIGVYIPIYIGYLNPILLQYINVFAGGTLLSLSLCHLIPEAEE 62

Query: 290 LQSMGD-STDALPVLVKVNCEDSVFGLNLLNRLQKVITEKQ 409
+ D S + V + + ++FGL ++ +K + Q
Sbjct: 63 IVRANDISLKFIGVEIPIVAYLTLFGLTIILFFEKALFSPQ 103


>tr|Q7TQY2|Q7TQY2_MOUSE Olfactory receptor 1286 OS=Mus musculus
GN=Olfr1286 PE=4 SV=1
Length = 305

Score = 34.3 bits (77), Expect = 4.6
Identities = 20/61 (32%), Positives = 34/61 (55%)
Frame = +2

Query: 161 FLVMATIPVYTGAINDDVLNVHLKFSGETLVDSSLCLITITLELQSMGDSTDALPVLVKV 340
FLV+ I + AI+ +L + L F G ++DS C I + ++L M +TD L +L+
Sbjct: 144 FLVIPWIVGFVHAISQMLLILDLPFCGPRVIDSFFCDIPLVMKLACM--NTDTLEILINA 201

Query: 341 N 343
+
Sbjct: 202 D 202